KEGG   Selenomonas sputigena: Selsp_2092Help
Entry
Selsp_2092        CDS       T01474                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00010  Glycolysis / Gluconeogenesis
ssg00051  Fructose and mannose metabolism
ssg01100  Metabolic pathways
ssg01110  Biosynthesis of secondary metabolites
ssg01120  Microbial metabolism in diverse environments
ssg01130  Biosynthesis of antibiotics
ssg01200  Carbon metabolism
ssg01230  Biosynthesis of amino acids
Module
ssg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssg_M00002  Glycolysis, core module involving three-carbon compounds
ssg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selsp_2092
   00051 Fructose and mannose metabolism
    Selsp_2092
   00562 Inositol phosphate metabolism
    Selsp_2092
Enzymes [BR:ssg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Selsp_2092
Exosome [BR:ssg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Selsp_2092
  Exosomal proteins of bladder cancer cells
   Selsp_2092
  Exosomal proteins of melanoma cells
   Selsp_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEC01039
UniProt: C9LYH5
Position
complement(2330185..2330937)
Genome map
AA seq 250 aa AA seqDB search
MARRPIIAGNWKMNNTIAEGVALVKELMPLVKDAKDVDVVACPTATALAAVAEAVKGSNI
HIGAQNVHWEKSGAYTGEISTDMLKEIGVDYCVLGHSERREYFGETDEGVNKRAKAAFAA
GITPIICCGEPLEIREANTYIDFVTKQIKAALDGFSADEAAQLVIAYEPIWAIGTGKTAT
FEQAEEVCAAIRATVAEVFNKDAAEGIRIQYGGSVKPATIAGLMEKPNVDGALVGGASLK
AKDFSEIVKF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagacccatcatcgcaggcaactggaagatgaacaatacgatcgccgagggc
gtagcgctcgtcaaggagctcatgccgctcgtgaaggatgcaaaggatgtcgatgtcgtc
gcttgcccgacggcaacggcgctcgccgctgtggcagaagccgtcaaaggctcgaacatc
cacatcggcgcacagaacgtgcattgggagaagagcggcgcctatacgggcgagatttcg
acggatatgctcaaggagatcggcgtcgactactgcgtgctcggccactccgagcgccgc
gagtacttcggcgagacggacgagggagtcaacaagcgcgccaaagcggcttttgctgcg
ggcatcacgccgatcatctgctgcggcgaaccgcttgagatccgcgaggcgaacacctac
atcgacttcgtgacgaagcagatcaaggcggcgctcgacggcttctccgccgacgaggcc
gcgcagctcgtcatcgcctacgagccgatctgggcgatcggcacgggcaagacggcgacg
ttcgagcaggcggaggaagtctgcgccgccattcgcgcgacggtcgccgaggtgttcaat
aaggacgcggcggaaggcatccgcatccagtacggcggcagcgtcaagcccgcaacgatc
gcaggactcatggagaagccgaacgtcgacggcgctctcgtcggcggcgcatcgctcaag
gcgaaggacttcagcgagatcgtgaaattctga

DBGET integrated database retrieval system