KEGG   Streptococcus suis P1/7: SSU0058Help
Entry
SSU0058           CDS       T00936                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssi  Streptococcus suis P1/7
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSU0058 (ruvA)
Enzymes [BR:ssi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SSU0058 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64531..65121
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVTVYTHQVIREDAHLLY
GFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQKNITYLTKFPKIGKKTA
QQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALGYRPAELKKIKKFFEGTN
DTAENYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattaaaggaattttaacaaaaataactgcaaaatacattgtggtagaa
acgcaaggagtaggctatatcttgcaggttgctaatccctacgcctattcaggacaagtc
cagcaagaagtgactgtctatactcatcaggtgattcgtgaagatgctcatttgctctac
ggatttgctacagaaaatgaaaaatccgtctttctgagtctgatttcagtatcaggtatt
ggtccaacaacagctctggctattattgctgttgatgataatgatggacttgttcgtgct
atcgagcagaaaaacattacctacctgaccaaatttccaaagattggcaagaaaacagcc
cagcagatgattttggacttggaaggcaagtttgtcatgagcgaagaagcgggtcctgtt
caacaagtagcaccatccagtgaaaatatcgcccttgaagaagccatggaagccatggaa
gcccttggttaccgcccagccgaactcaagaaaatcaagaaattctttgaaggcaccaac
gacaccgcagaaaactacatcaagtcagcccttaaaatgctgatgaagtaa

DBGET integrated database retrieval system