KEGG   Streptococcus suis P1/7: SSU0167Help
Entry
SSU0167           CDS       T00936                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssi  Streptococcus suis P1/7
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSU0167
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSU0167
   00600 Sphingolipid metabolism
    SSU0167
Enzymes [BR:ssi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSU0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
157657..159858
Genome map
AA seq 733 aa AA seqDB search
MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETASYQYVREDEYRALTSF
VEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFVYQGHAIYAGRSALKGL
PHLYLDEEGQADSLDIYLLDEDSQTRLVLSYTIFRDYPAVTRSARFEQLGEKSVCLNRAL
SMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSIYSLKGASSAEHNPFMALKRPTA
DEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERFSWTLDKGEEFQTPEVVMVY
SEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAMSFDFDEETILSLAKEAAGLG
VELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGIIDQVHAMGMKFGLWIEPEMVNR
DSELYRAHPDWIFHHPQHSQSHGRHQYTLDLSREDVYQNIHDQLHRLLAEHDIDYIKWDM
NRYMTEVFTCTREADRQGETFHRYILNLYRLYDSLIAAFPTVLFESCSSGGARFDPGMLY
YAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHVSASPNQQLGRATPLNTRANVAFFG
SFGYELDLFECSQEELEEMKEQIAFYKTHRKIFQQGIFTRLKSPFDGEITAWQVQSSDGQ
QVIVGYYRRLTTANLSYQRLYLQGLEEEAVYHLDGEVYTGSQLMHTGLSIRHGDHVGDNK
DFTSCLMVLQKQQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaattatctttcatgaaaagacaaaggaattccatctttacaatgagtttattagc
tatgtgttgacggtcttgcctaatggtcatattggtagtttgtattatggaaagcgtgta
acagaaacagcttcttatcagtatgtacgtgaagatgagtatcgtgctttgacttccttt
gtagaagacgatgaccgtttcttttcgctccaatatgccaatcctgaatttgcttgttat
ggtacaacggactatttttctccgacttttgagttggtgcagaaggatggtagcagtcta
tcgcactttgtgtatcaaggtcatgcgatttatgctgggcgatcggctttgaagggtctt
cctcatctctatctggatgaggagggacaggcagatagtttggatatttatttgttggat
gaagattcgcagacccggctggtcttgtcttatacgatttttcgagattatccagcggtg
actcgctctgctcgttttgaacaactcggagaaaaatctgtctgtttgaaccgtgccttg
agtatgacactttgtctgcctgatatggactatgattggttgcatttggatggggcttgg
gggcgtgagcggcatctgcaactatcgcctcttcatcaaggttgtcagtctatttacagt
ctcaaaggggctagtagtgcggagcacaatccctttatggctttgaaacgcccaactgcg
gatgagcaacagggagaggtactaggcttctcgctcgtctatagcggaaactttttggcg
caggtggatgtgagttctttccaaaaaacaagagtgagtatgggaatccatcctgagcgt
ttttcttggacattagataagggagaagagttccagacgcctgaggttgttatggtttat
agcgagcatggtttgaatggcatgagccaaacctatcaccgcctcttccaaaaacatctg
gtacgtggctattggcgtgatagagaacgacctgttctcttgaataactgggaagccatg
agttttgattttgatgaggaaacaattctttccttggccaaagaggctgcaggtcttggt
gttgaactctttgtcatggatgatggttggtttggcaagcgaaaccatgaccgagcaggc
ttgggagattggacggtcaaccgagagaaattaccaagtggcttgacagggattattgac
caagttcatgctatgggaatgaaatttggactttggatcgaacctgaaatggtcaatagg
gacagcgagctttaccgagcgcatccagactggattttccatcatcctcagcatagtcaa
tcgcacggacgccaccaatatacgctggatttgtcgagggaggatgtttatcaaaatatt
catgaccaactccatcggctgttggctgagcatgatattgattatatcaagtgggacatg
aatcgctatatgacagaggtctttacatgtacacgggaggcggatcgacaaggtgagacc
ttccatcgctatattctcaatctctaccgtttatatgatagcctgatagcagcttttccg
acagtcttattcgaatcttgttcaagtggtggagctagatttgatccagggatgctctac
tatgcaccgcaaacctgggtcagcgatgacacggacgccatggaacgcttgaaaatccaa
tatggaacgagcatggtctatcctttgaatagtatgggttgccatgtgtcagctagtcca
aatcagcagttggggcgtgctactccactaaacacacgtgccaatgttgcattctttgga
agttttggctatgaattggatttgtttgagtgtagccaagaagagttggaagagatgaaa
gagcagattgccttttacaagactcaccgtaagattttccaacagggtattttcactcgt
ctgaaaagtccattcgatggagaaataacggcttggcaggtccaatcctcggatggtcag
caagtcatcgtgggttattatcgtcggttgacaacggctaatctctcctatcaacgcttg
tatttgcagggattggaagaggaagcggtctatcaccttgatggagaagtttatactggt
agccaattaatgcatacaggtttgtcgattcgacatggggaccatgttggagacaataag
gactttacttcttgtttgatggtccttcagaaacaacagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system