KEGG   Streptococcus suis P1/7: SSU0176Help
Entry
SSU0176           CDS       T00936                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssi  Streptococcus suis P1/7
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU0176
Enzymes [BR:ssi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSU0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170652..172052
Genome map
AA seq 466 aa AA seqDB search
MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYSQEPELFHQQIGPEQTS
TFYEHFQSDLDLLVETCHSIFRTSIQWSRLIPEGIGEVNPQAVEFYRAVFAGIRERGIKL
LVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFGDLVDHWITFNEPIVPVECGY
LGSYHYPCKVDAKAAVVVAYHTQLASSLAVRACHQLHPDHKISIVLNLTPAYPRSQSPED
LQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHGLRPETTEEELTIIKENRVDFLGVN
YYQPLRVQAPSEDGWNGEPTFLSQYFQPYDKPDKKINPHRGWEIYEEGLYDIAKNIQENY
GNIEWLVTENGMGVEGEGVFEENGMIQDDYRIHFMEDHLIQLHRGIDEGANCKGYMVWTF
IDCWSWLNTYKNRYGLVSLDLQTQKRTVKKSGYWFKQVSAKNGFIR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgagcaaagagagtatcgttttccagaaggttttttgtggggatcctccact
tcagggcctcaaagtgaaggaagtgtagctggtgatggaaaggggtggaataactgggat
tactggtacagtcaggaacctgagctctttcaccagcaaataggaccggaacaaacatcg
actttctatgaacatttccagtcagatttggatttgttggtggaaacatgtcatagtatt
tttcgcacctctatacagtggtcacgtctgattccggaagggataggcgaggtcaatccg
caagctgtggagttttatagggctgtatttgcaggtattcgagagcgtgggataaagctt
ttggtcaatctttatcatttcgatttgccttatgtcttacaggaaaaagggggctgggaa
aataaggagattgtctgggcctatgaggcttatgctcgccagtgtttcagcctctttggg
gatttggtggatcattggattacctttaatgaacccattgttccagtagaatgtggctat
ctaggaagctatcattatccttgcaaggtggatgcaaaggcagctgtggtcgtagcgtat
catacgcaattagccagttctttggcagttcgggcctgtcaccaactacacccagaccac
aaaatttccattgttctcaatcttactcctgcctatccaagaagtcagagtccagaagat
ttacaggcagcacggattgctgagctatttcaaacgagaagctttttggatccatccgtt
ttgggacaatacccgagggagctggttgacattcttgaaaaacacggtttacgtccagaa
accacagaggaggaattgaccattatcaaagaaaatagggttgacttcctgggggtgaat
tattaccagcccctgcgcgtgcaggctccttcagaagatggatggaacggagagcctact
ttcctatcccaatatttccagccttatgataagcctgacaagaaaatcaatccccataga
ggctgggaaatttacgaagaagggctgtacgatattgctaaaaatatccaggaaaactat
ggaaatatcgaatggttggtaactgagaacggcatgggagtcgaaggggagggtgttttt
gaagaaaatggcatgattcaggatgactatcggattcacttcatggaagaccatttgatt
cagctccatcgaggtattgatgaaggggcgaactgtaagggctatatggtctggaccttt
attgactgctggtcttggttaaatacctataagaaccgatacggtttggtctcgcttgac
cttcaaactcagaagcgtactgtcaaaaaatctggatattggttcaagcaagtgagtgct
aaaaatggttttattagatag

DBGET integrated database retrieval system