KEGG   Streptococcus suis P1/7: SSU0261Help
Entry
SSU0261           CDS       T00936                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase]
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ssi  Streptococcus suis P1/7
Pathway
ssi00010  Glycolysis / Gluconeogenesis
ssi00071  Fatty acid degradation
ssi00350  Tyrosine metabolism
ssi00620  Pyruvate metabolism
ssi00625  Chloroalkane and chloroalkene degradation
ssi00626  Naphthalene degradation
ssi00650  Butanoate metabolism
ssi01100  Metabolic pathways
ssi01110  Biosynthesis of secondary metabolites
ssi01120  Microbial metabolism in diverse environments
ssi01130  Biosynthesis of antibiotics
ssi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU0261 (adhE)
   00620 Pyruvate metabolism
    SSU0261 (adhE)
   00650 Butanoate metabolism
    SSU0261 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SSU0261 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSU0261 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSU0261 (adhE)
   00626 Naphthalene degradation
    SSU0261 (adhE)
Enzymes [BR:ssi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSU0261 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SSU0261 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAR44650
Position
267021..269672
Genome map
AA seq 883 aa AA seqDB search
MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDYIVAKASVAALDKHGEL
AMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARVVYEAAVAAGAPENCIQW
VTKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAEFKSYKTYFVNKKEKALLEEYCFGV
KANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILAAEVAEIGEKEPLTREKLSPV
IAVLKVEGRAEGLEAARQMVEFHGLGHSAAIHTEDAELAKEFGTIVRAIRVIWNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIKKVGRRRNNMQWFKVPSKTYFER
DSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLDLRRNKVVYQIFSDVEPDPDITTV
YKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPTVDFHDLVQKFMDIRKRAFKFPE
LGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPAH
VTADTGMDVLTHATEAYVSTVANDFTDGLALQAIKLVFENLESSVKNADFVSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGGRFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YKADEKYQDIARLLGLPCSTPEEAVAAYAQAVYDLGERIGIQMNLKAQGIDEKELKEHSR
ELALLAYEDQCTPANPRLAMVDHMQEIIEDAYYGYKERPGRIK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaagtagtatcaccagaagaaaagttggtagaagcgcgcaagcacgtc
gatgagcttgttcaaaaaggtttggttgctcttgatgagttccgtaaacttggtcaagaa
gaagtagactatattgtagcgaaagcttcggttgcggcccttgataaacatggcgaattg
gcaatgcacgcctttgaagaaaccaaacgtggtgtattcgaagacaaggctactaagaac
ttgtttgcctgtgagcacgttgtcaataacatgcgccatacaaaaacagttggtgtcatc
gaggaagatgatgtaacaggtttgactttgattgctgagccggtcggtgttgtttgtggt
atcacaccaacaacaaacccaacttctacagcaatctttaaatcattgattgccttgaag
acacgtaatccaattgtctttgccttccacccatctgcgcaagaatcttctgctcatgca
gctcgtgttgtctatgaagcagctgtggcagctggtgcccctgaaaactgtatccagtgg
gtaacaaaaccatctatggaagcaacgtctgagttgatgaaacatgatggtattgcaaca
atccttgcaactggtggtaacgcaatggtgcgtgcagcttactcttgtggtaaacctgcc
cttggtgtaggtgcaggtaacgttccagcctatgttgaaaaatcagcaaacatccgtcag
gcagcacatgacatcgttatgtctaagtcatttgacaacggtatggtctgtgcgtcagaa
caagcggttatcattgataaagaagtttacgatgagtttgtagcagaattcaaatcttac
aaaacttacttcgttaataagaaagaaaaagctcttcttgaagaatactgcttcggtgtg
aaagctaacagcaaaaactgtgctgaaggtaaattgaacgcagacatcgttggtcgccca
gctgcatggatcgctgagcaggccggcttctcagtaccagaaggtacaaacatcttggca
gctgaggttgctgaaatcggtgagaaagaaccattgactcgtgagaaattgtcacctgtt
attgccgtcttgaaagttgaaggtcgtgcagaaggtcttgaagcagctcgccaaatggtt
gaattccacggtctcggtcactctgcagctattcatacggaagacgcagaattggcgaaa
gagtttggtacaatcgtacgtgctatccgtgttatttggaactctccatctactttcggt
ggtatcggtgatgtttacaacgcattcttgccatcattgacacttggttgtggttcttac
ggacgcaactcaatcagtgataacgtaagtgctatgaacttgctcaacatcaagaaagta
ggaagacgtagaaataatatgcaatggtttaaagttccttctaaaacatacttcgaacgt
gactctatccaatatctccaaaaatgccgtgacgttgaacgtgtcatgatcgttacagac
cgtgccatggtagaacttggattcctagatcgtatcatcgaacaattggaccttcgtcgt
aataaagttgtttatcaaatcttctcagacgttgagccagatccagacatcacaacggtt
tataaaggtacagaattgatgcgtaccttcaaaccagatacaatcatcgcactcggtggt
ggttcaccaatggatgctgccaaagttatgtggctcttctacgaacaaccaacagttgat
ttccatgacctagttcaaaaattcatggatatccgtaaacgtgccttcaagttcccagaa
cttggtaagaaatctaagtttatcgcgattccaactacctcaggtacaggttcagaagta
acaccgttcgccgtaatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgttgacccagcactcgtattgacagtacctgcacac
gttacagcagatactggtatggacgtattgactcacgctacagaagcatacgtttcaaca
gtagctaacgactttacagatggtttagcacttcaagctatcaaactagtatttgaaaac
cttgaaagctcagtgaagaatgctgactttgtatcacgtgagaaaatgcacaacgcatca
actatggcaggtatggccttcgccaacgcattcctaggtatttctcactcaatggctcat
aagattggtggacgtttccataccgttcacggtcgtacaaacgctatcttgcttccatac
gttatccgctacaacggtactcgtcctgccaagacagctacatggcctaagtacaactac
tataaagcagatgaaaaataccaagacatcgcacgtcttctaggcttgccatgctcaaca
ccagaagaagctgttgcagcatacgcacaagcagtttacgacctcggtgaacgcatcggt
atccaaatgaatttgaaagcacaaggtatcgacgagaaagaactcaaagaacactctcgc
gaattggctcttcttgcctacgaagatcaatgtaccccagctaacccacgtctagcaatg
gttgaccacatgcaagaaatcatcgaggatgcctactacggttacaaagaacgtccaggt
cgcatcaagtaa

DBGET integrated database retrieval system