KEGG   Streptococcus suis P1/7: SSU0262Help
Entry
SSU0262           CDS       T00936                                 

Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssi  Streptococcus suis P1/7
Pathway
ssi00260  Glycine, serine and threonine metabolism
ssi00750  Vitamin B6 metabolism
ssi01100  Metabolic pathways
ssi01110  Biosynthesis of secondary metabolites
ssi01120  Microbial metabolism in diverse environments
ssi01230  Biosynthesis of amino acids
Module
ssi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSU0262
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSU0262
Enzymes [BR:ssi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSU0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAR44652
Position
270086..271570
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFSVLKDASYQDVAKLIL
SAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELFRGSTIAFKDMALSILP
YLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNNVLTD
FFATGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGNDAAKTAELMEALNTAGQYDIQ
GADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQTPTV
IASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVDLPPAVDGLETAPVRHNTVVA
AADMQTEVERYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcggctagtcaagcg
attttgcagggcttggcgaccgacggtggtttgtttacaccgctttctattccaacagtt
gacttggatttttctgttttgaaagatgcttcttatcaagacgttgccaagctgattttg
tcggctttcttggatgattttacggcagatgagttggactactgtatcaataacgcctac
gacagtaagtttgacacgtcagttattgccccagtggttaagctaaaaggtcagtacaac
ttggagctcttccgtggctcaaccattgccttcaaggatatggctctgtccatcctccct
tacttgatggcgacggcgactaaaaagcacggtttggaaaacgaaattgtcatcctgacc
gcgacttcaggcgatacaggcaaggcagccatggctggttttgcggacgttcctggcaca
caaatcattgtcttctatccgcgtgacggggtatctaaggtccaagaattgcagatgacc
acgcagacaggggctaatacccacgtggtggctattgacggtaacttcgacgatgcccag
accaatgtcaaacacatgttcaacgatgaggcactccgtgccaagttggcggctaagaaa
ctccagttttcatctgccaactctatgaacatcggccgcttggtgccacagattgtttac
tatgtctatgcctacgctcagctggttaagactggtgagattgcggcgggcgacaaggtc
aacttcaccgttccaacaggaaactttggaaacatcttggcagcttattacgccaaacaa
atcggtctgccagttggcaagctcatctgtgcgtccaacgacaacaatgtcctaaccgac
ttcttcgcgacaggcgtttacgataagaaccgtaccttccgcgtgaccaccagtccgtcc
atggacatcttggtgtcttctaacttggagcgcttgattttccatctctttggcaatgac
gctgcaaaaacagctgagctgatggaagccttgaacacagctggtcagtatgacattcaa
ggggctgacgcggaaatcctctcgctctttgctgccgcctttgcgacggaagaagaaacc
gctgcggaaatcaagcgtgtctatgacgagtcagactacattgaagatccacatacggct
gttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaaactccgacagtg
attgcttctacagcaagtccttacaagttccctgtggttgcggtagaggcggtgacaggc
cagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatttcaggtgtagac
ttgccaccagctgtggacggcttggaaacggcacccgtccgccacaataccgtcgttgca
gctgccgatatgcagactgaagtagaacgctatttgggtgtttaa

DBGET integrated database retrieval system