KEGG   Streptococcus suis P1/7: SSU0642Help
Entry
SSU0642           CDS       T00936                                 

Definition
type III restriction-modification system, restriction enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ssi  Streptococcus suis P1/7
Brite
Enzymes [BR:ssi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SSU0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
661916..665014
Genome map
AA seq 1032 aa AA seqDB search
MKLQFKQQQFQLDAVASVVDVFVGQGKHSGFDYHMDKGQGMGAELDMNFIGFRNAPIQLS
QETVSQQVRAKQLSYGLKPSENLSIQKVDGRPSYNLTIEMETGTGKTYTYIRTLMELNKQ
YGWLKFIIVVPSIAIREGVLKSFEIMADHFQMEYGKKPRYFVYDSSRLGELDKFANSSDI
QVMIINSQAFNATGADARRIHTEQESFRWRKPIDVIAATNPILIIDEPQSVEGKKTKERL
EDFKPLFTLRYSATHKDKHDMIYRLDALDAYNKKLVKKIAVKTVEQTATTGTQGYLYLQE
LVPQKSGSPKARIEFEVRTKSGDVKWVTKLVEEPFALFEESGNLPAYQGGWTLSHFDARE
GENSIQIGANRKLYVGEVIGETNEDDIRRIQIRETIASHLQKEERLYKRGIKVLSLFFID
EVAKYKCYDEQNDAYNSTYAQMFEEEYEAQVKALLADLNLHGSNFWHYLNKHQEGNPVHA
GYFSVDKIKKSDKVKFVDYKSATEKKNNQSNDKDAYDLIMKDKERLLSFEEPIRFIFSHS
ALKEGWDNPNVFQICTLKNTGTETEKRQKIGRGMRLAVDQKGVRQDEELLGADVHNINKL
TVIANESYEDFAKNLQRELREILADRPSKVEVDFFVNKVLENEAGQKLTVTKEVAKEIER
QLIKQDYIDSKGNLTATYFEQKETSQFTLSENLAGYEVAVKDILETIYDANRYQIEREND
SEVVFAREINPDNYNRQEFKRLWESIHHKSTYYVEFDDEELIEKSVKALNESLFVKKPSY
MITEAEAREMQAKHGLDFKVNKNGKRQSVLDKSSIQLRYDLLGEIASRTELKRKTVANIL
KQISPSKFDMFSYNPEAFIQQVSRLINEQKASQVIEHIRYNILEETFDSSIFTDNPLSGK
VSDANMLKSEKGVYNYVKVDSGTERKFKEDLERFDDVMVYAKLPSKFKISTPLGDYNPDW
AIAFRDGSVKHVYFVAETKGSMSSLQLKGAELAKIECAKAHFKALKEKGLIADDRIYDVV
DSYEKLLEIVRG
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcaatttaagcagcagcaatttcagttagatgcggtggcctctgttgtggat
gtttttgttggtcagggcaaacatagcggttttgattaccacatggataaaggtcaggga
atgggtgcggaactggacatgaattttatcggtttccgcaatgctcccattcagctttcg
caggaaactgtcagccagcaggttcgagctaagcagctcagctatggccttaaaccatct
gaaaacttgtctattcaaaaagtggatggtcgtccgtcttacaatttgactattgagatg
gagacggggacagggaagacctacacctatatccgtaccttgatggagctcaataagcag
tatggttggctcaagtttatcatcgtggtgccgagcattgctattcgtgagggagtgctc
aagtcctttgaaatcatggcggaccatttccagatggagtatggcaagaagccacgctat
tttgtctatgattctagccgtttgggcgagctggacaagtttgccaactcctcggacatt
caggttatgattatcaactcacaagcctttaatgccactggagcagatgcccgtcgtatt
cacaccgagcaggaaagtttccgctggagaaagccgattgatgtcattgcggcgaccaat
cctattttgattatcgatgagcctcagtcggttgaggggaaaaagactaaagaacgcttg
gaggacttcaagcccctatttactctccgctattcagccactcataaggacaagcacgat
atgatttatcgtctggatgccctggacgcctacaataaaaagttggtcaagaagattgcc
gttaagaccgtggagcagactgcaaccacaggaacacaaggctacctttatctgcaagaa
ctggttccgcaaaaatcaggttctcctaaggctcggattgagtttgaagtgcggaccaag
tcaggcgatgtcaaatgggtgaccaaattggttgaagagccttttgctctttttgaagag
tcaggcaacctaccagcctatcaaggcggttggaccttgagccattttgatgcgcgtgaa
ggtgaaaattccattcaaatcggtgccaatcgcaaactctatgtgggcgaagtgattggg
gaaaccaacgaagatgacatccgtcgtatccagattcgggaaaccattgccagtcacctg
caaaaagaagaacgcctttacaaacgaggtatcaaggtgctatcccttttcttcatcgat
gaagttgccaagtataagtgctatgatgagcaaaatgatgcctacaatagcacctatgcc
cagatgtttgaagaagagtatgaagcccaggtcaaggctttattggctgatctcaacctt
catggaagtaacttttggcattatctcaacaagcaccaagaaggcaatcctgttcatgca
ggttatttctctgtcgataagataaaaaaatcggataaggtcaagtttgtggactacaag
tctgctacggaaaagaaaaataaccagtctaacgacaaggatgcctatgatttgataatg
aaggacaaggaacgtctgctgtcttttgaggaacctattcgctttatcttttctcactca
gccctcaaagaaggctgggacaatcctaatgtcttccagatttgtaccttgaaaaataca
ggtacagaaacagaaaaacgacaaaagattggtcgtgggatgcgtctagccgtcgaccaa
aaaggtgttcgtcaggatgaggagcttttaggagctgatgttcataatattaacaagttg
accgtcatcgccaatgaaagctatgaagattttgctaagaacttgcaaagagaactcagg
gaaatcttggctgatcgaccaagcaaggtggaagtggatttttttgtcaacaaggtcttg
gaaaatgaagctggtcaaaaactgactgtcaccaaggaagtggctaaagagattgaacgc
cagttgattaagcaagattatattgacagcaaggggaatctgaccgctacttattttgaa
caaaaagaaacaagtcagtttactctatctgaaaatctggcaggctatgaagtggctgta
aaagatattctagaaacgatttacgatgccaatcgctaccagattgaacgtgaaaatgat
tcggaagtggtttttgcaagagaaatcaaccctgataactacaatcgtcaagagtttaaa
cgtttgtgggaaagtattcatcacaagtccacctactatgtcgaatttgatgatgaggag
ttgattgaaaagtctgttaaggccttgaatgagtccttgtttgttaaaaagcctagttac
atgattacagaggctgaagcaagggaaatgcaggcgaaacacggtttggatttcaaggta
aataagaacggcaagcgtcagtctgtgctggataagtcttctattcaactccgctatgat
ttgctgggtgaaattgccagtcgcacggagttgaaacggaaaacagtcgccaatattttg
aagcagatttcgccaagcaagtttgatatgttttcctataaccctgaggcatttatccaa
caagttagtaggctcatcaatgagcaaaaggcgagtcaggtgattgagcatatccgctac
aatatcctagaggaaacttttgatagttctatttttacggacaatcctttgagtggtaag
gtgtcagatgcaaatatgctcaagtctgagaagggtgtttataattatgtgaaggttgat
tctggaacggagaggaagttcaaagaggacttggagcgattcgacgatgtcatggtctat
gccaaattgcctagcaagtttaagatttccacaccgctgggtgattacaatccagactgg
gccattgccttccgagatggttcggtcaagcatgtttacttcgtagctgaaaccaaaggt
tccatgtctagtttgcaactgaaaggggcggagttggcaaagattgagtgtgcaaaggcc
cacttcaaagccctaaaagaaaaaggattgattgcggatgatcggatttatgatgtggtt
gattcctatgaaaaattattagaaatcgtgagaggatag

DBGET integrated database retrieval system