KEGG   Streptococcus suis P1/7: SSU0675Help
Entry
SSU0675           CDS       T00936                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssi  Streptococcus suis P1/7
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
700796..702310
Genome map
AA seq 504 aa AA seqDB search
MSTEKYIMAIDQGTTSSRAIIFNKKGEKVGSYQKEFTQIFPKPGWVEHNANEIWNSVQSV
IAGSFIESGVRPDQIEGIGITNQRETTVVWDKETGLPIYNAVVWQSRQTAHIADQLKADG
HADMIHQKTGLVVDAYFSATKVRWILDQVPGAQERAEKGEILFGTIDTWLVWKLTDGKCH
VTDYSNAARTMLYNIEELKWDDEILSLLNIPKAMLPEVRSNSEVYGTTAPFHFYGAEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIVMNTGEEMQLSQNNLLTTIGYGIGGKVY
YALEGSIFIAGSAVQWLRDSMRMVTTSPESEELARKSTSNDEVYVVPAFTGLGAPYWNSD
ARGSVFGLTRGTTKEDFVKATLQSIAYQVRDVIDTMQLDTGIDISVLKVDGGAAMNSLLM
QFQADILGIEIARAQNLETTALGAAFLAGLAVGFWKDLDELKELNAVGQSFQPTMNEARK
EQLYKGWKKAVAATQLFAEVDEEQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaaaaatatatcatggccattgaccaaggaactacaagttcacgtgccatt
atcttcaataaaaaaggtgaaaaggttggcagttaccaaaaagagtttacgcaaattttc
cctaaaccaggttgggttgaacacaacgccaatgaaatttggaattctgttcagtctgtg
attgcagggtcctttatcgaaagcggtgttcgtcctgatcagattgaaggaattggtatt
accaaccagcgtgaaacaaccgttgtctgggataaggaaacaggtcttccaatctacaat
gccgttgtctggcaatctcgtcaaacagctcatattgctgaccagctgaaggcggatggt
catgcagatatgattcatcaaaagacaggtctagtagtcgacgcctacttctcagcaacc
aaagttcgttggattttagatcaagtccctggagcgcaggaacgtgctgaaaaaggtgag
attctctttggaaccattgatacttggttggtttggaaattgactgatgggaaatgccat
gtgacggattattcaaacgcagctcgtaccatgctctacaacattgaagagttgaaatgg
gatgatgaaattttatctcttctcaatattccaaaagccatgctgccagaagttcgttca
aactctgaagtttacggcacaacagctccattccatttctatggcgcagaagtgccaatc
tctggcatggcaggtgaccaacaggctgccttatttggacaattagcatttgagccaggt
atggtgaaaaatacttacggaaccggttccttcatcgtgatgaatacaggtgaagagatg
cagttgtcacagaacaaccttctcacaacaattggctatggtatcggtggcaaagtctat
tatgcgcttgaaggatctatctttatcgctggttcggcggttcaatggctccgtgacagc
atgcgaatggtgactacatcacctgagtcagaagagcttgctcgtaagtctaccagcaat
gatgaagtctatgttgttccagcctttacaggacttggtgctccgtattggaactcagat
gcgcgtggctcagtctttggtctcactcgtggtacgactaaagaagacttcgtcaaagca
actcttcaatccattgcctaccaagttcgagatgttattgacaccatgcaattggataca
ggtattgatatttctgtcttgaaggttgacggtggtgcagcaatgaacagcctcctcatg
caattccaagcagatattttgggtattgaaatcgcacgcgctcaaaaccttgaaactaca
gctcttggagcagcattcttagcaggtttagcagttggtttctggaaagatttggatgaa
ttgaaagaactcaacgctgtcggccaatccttccaaccaaccatgaacgaagctcgtaaa
gaacaactttacaagggatggaaaaaagctgtcgcagcaactcaactatttgcagaagtg
gatgaagagcaataa

DBGET integrated database retrieval system