KEGG   Streptococcus suis P1/7: SSU0676Help
Entry
SSU0676           CDS       T00936                                 

Gene name
glpO
Definition
alpha-glycerophosphate oxidase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
ssi  Streptococcus suis P1/7
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SSU0676 (glpO)
Enzymes [BR:ssi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SSU0676 (glpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702386..704215
Genome map
AA seq 609 aa AA seqDB search
MEFSKETRRLAIERMQDRQLDLLIIGGGITGAGVALQAAASGMETALIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQNIAPHIPKPDPMLLPVYDEPGSTFSLFRL
KVAMDLYDLLAGVNNTDMANKVLTREEVLEREPNLKQEGLIGGGVYLDFRNNDARLVIEN
IKRAAKDGALIASRAKAEKFIKDDAGKVVGIVARDLLTDRTFEIRARLVINTTGPWSDEV
RNLGGEGSGVLQMRPTKGVHLVVDSSRLSVPQPTYFDTGHADGRMVFVLPRENKTYFGTT
DTDYTGDLANPMVTQEDVDYLLDIVNNRFPEANLTLDDIESGWAGLRPLLSGNGASDYNG
GNNGKLSDDSFNSLIETVKGYMNNEKTRDDVEHDLTHLEGSVSEKHLDPSAVSRGSALDR
DDNGLLTLAGGKITDFRKIAEGAIEKVADILKEEHGRSFKLINSKTYPVSGGELNPANVA
EEIEHLAQLGVKKGLLYDDALYLANLYGSNAPKVFVLNHKVEAVSGLNKRDLLSLHYAMK
EEMTLTAVDYLLRRTNYMLFMREQLDAVALEIIKEMAAYYAWSEEEVAQQKQLLADTLVK
NDLTYLKEK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaaagaaacaagacgcttagctattgagcgaatgcaggatcgtcaactt
gacctcctcattatcgggggtggtattacaggtgcaggtgtggctttgcaggcagcagca
agcggtatggaaacagccttgattgaaatgcaggactttgcagaaggaacttccagtcgc
tcaaccaaattggtccacggtggtcttcgctacctcaaacaatttgacgtggaagtggta
tccgataccgtatctgaacgtgctgtagtacaaaatatcgccccacatattccaaagcca
gacccaatgcttttaccagtctatgatgagccaggttctaccttcagcctcttccgtttg
aaagtggccatggacttgtatgatctcttggctggcgtcaataataccgatatggccaat
aaggtcttgacaagagaagaagtacttgaacgcgaaccaaacttgaagcaagaaggattg
attggtggcggtgtctatcttgatttccgcaacaatgatgctcgtttggttattgaaaat
atcaaacgtgcagccaaggatggtgccttgattgccagccgtgccaaagctgagaaattc
atcaaagatgatgctggaaaagttgtcggtatcgtcgctcgtgatttgctgacagaccgc
acctttgaaatccgtgcgcgtttggtcatcaatacaacaggaccatggagtgatgaagtg
cgtaatctgggtggagaaggttcaggcgttctccagatgcgtccgaccaagggtgtgcac
ctagttgtcgatagctctcgcttgtctgtaccacagccgacttactttgatactggccat
gcggatggtcgaatggtctttgtccttccgcgtgaaaataaaacctattttggtacgact
gatacagactatactggtgatttggcaaatccaatggtaacccaagaagatgttgactac
ctgcttgatattgtcaacaatcgcttcccagaagcaaacttgaccctggatgacattgag
agtggttgggcaggtcttcgtcccctcttgtctggaaatggtgcttctgactacaatggt
ggaaacaacggtaagctcagcgatgacagctttaatagcttgattgaaacggtcaaaggt
tatatgaacaatgaaaagacacgtgacgatgtggaacatgatttgacccatctggaaggc
agcgtttctgaaaaacacttggatccttcagctgtatcacgtggctctgcccttgaccgt
gatgacaatggtttgctgactcttgctggtggtaagattactgacttccgtaagatagcg
gaaggtgcaattgaaaaagtggcagacattctcaaagaagaacatggtcgcagcttcaaa
ctcatcaattctaagacctatccagtctctggtggtgaattgaaccctgcaaacgtagca
gaagaaattgaacatcttgctcaactaggtgtgaagaaaggtctcctttatgatgacgcc
ctttacttggcaaacttgtacggttcaaatgctccaaaagtctttgtattaaaccataaa
gtagaagccgtttctggcttgaacaagcgtgatttgctttcccttcactatgctatgaag
gaagagatgaccttgactgcagttgactatcttcttcgtcgtaccaactacatgctcttt
atgcgtgagcagttggatgcagttgcgcttgaaatcattaaggaaatggcagcttattat
gcttggtcagaggaagaagttgctcaacagaaacaattgttggcagatacacttgttaag
aatgatttgacctatttgaaagaaaaatag

DBGET integrated database retrieval system