KEGG   Streptococcus suis P1/7: SSU0779Help
Entry
SSU0779           CDS       T00936                                 

Gene name
dyr
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssi  Streptococcus suis P1/7
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ssi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813422..813934
Genome map
AA seq 170 aa AA seqDB search
MTKKIVAIWAQDENGLIGKGDRLPWSLPADLAHFKKTTTGHTMVMGRITFDGMGKRALPN
RHTIVLTTDKTYQLESERITILHSVEDVLDWYNKQEQTLFVIGGGQIFTAFAPYIETLIV
TDIHGQFNGDVYFPKAFPMEKFQLQSANLRPKDEKNPYDFTIKTYERRDG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagattgttgccatttgggctcaagatgaaaatggattgattggaaaaggt
gatagacttccttggtcattgccagctgacttagctcatttcaaaaaaacgacaacaggt
cacacgatggtgatgggacgtataactttcgacggcatgggtaaacgtgctcttcccaat
cgtcacaccatcgttttgacaacggataaaacctatcaactagagagtgaacgtattacc
attttacacagtgtggaagatgttctagattggtataacaaacaggagcagacactattt
gtgattggtgggggacaaatttttactgcttttgcaccttacattgaaacattaatagtg
acagatattcacggtcaatttaatggcgatgtgtattttccgaaagcatttcctatggag
aaatttcagctacaaagcgccaatttacgtccaaaagacgagaaaaacccgtatgatttt
acaataaaaacctatgaaagaagagatggttag

DBGET integrated database retrieval system