KEGG   Streptococcus suis P1/7: SSU0989Help
Entry
SSU0989           CDS       T00936                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ssi  Streptococcus suis P1/7
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1003581..1004144)
Genome map
AA seq 187 aa AA seqDB search
MSKQEQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTAVFSEG
HEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLARAVEVASRRPQLQER
LTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKYKEDAILRREL
LSMIHNK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaagaacaaatcgaacaaacaatttatcaattattggaattattgggtgag
gacccgaatcgtgaaggtttattagatacgcctaaacgggttgctaagatgtatttagaa
atgtttaacggcctagaagaggatcccaaagaccaatttacagctgtcttttcagaaggt
catgaagaggttgttttggtcaaggatattccttttcattctatgtgtgaacaccatttg
gtacccttttatggcattgcccatgtagcttatattccgagtaaggggcgtgtgacaggt
cttagcaaattggcgcgtgcagtggaggtagcaagtcgtcgccctcaattgcaggaacgc
ttgacccatcaggttgcccatgcccttcaagatgcccttgaaccagaaggtgtttttgtc
atggtcgaagcagagcacatgtgcatgagcatgcgtggtattcgcaagccaggtagtaag
acagtgaccacagttgctcttggcaaatacaaggaagatgccatcttgcgccgtgaactc
ttgtccatgattcacaataaatag

DBGET integrated database retrieval system