KEGG   Streptococcus suis P1/7: SSU1217Help
Entry
SSU1217           CDS       T00936                                 

Definition
zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssi  Streptococcus suis P1/7
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSU1217
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU1217
  Lipid metabolism
   00071 Fatty acid degradation
    SSU1217
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSU1217
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSU1217
   00626 Naphthalene degradation
    SSU1217
Enzymes [BR:ssi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSU1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1246659..1247702
Genome map
AA seq 347 aa AA seqDB search
MKAAIYEKAGKMTVAEIEKPSLQAKDDVIIKVVRACVCGSDLWGYGEDIHHDHGDTNSGH
EAIGIVEEVGEDITTLVPGDFVIVPFTHGCGHCDACRAGFDGTCDNHPGYTNWGNNYQSQ
YIRFHYGNWALVKIPGQPSDYSEGMIKSLLTLADVMPTGYHATRVADVKPGDKVVVIGDG
AVGQCAVIAAKMRGASQIIMMSRHADRQQMALESGATAVVAERGEEGIAKVREILGGGAD
AALECVGTEASIDQALGVLHNGGRIGFVGVPHYNNHALGSTFAQNIIIGGGSASVTTYDK
EILLDAVLKGDINPGRVFTQTYSLDNIDQAYKDMANRKTIKAMITVD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctatttatgaaaaagccggtaagatgaccgttgcagaaatcgaaaaacca
agccttcaagccaaagatgacgtcattatcaaggtcgttcgggcctgtgtctgtgggtcg
gacctttggggctacggagaagacattcaccatgaccacggtgacacaaactctggtcat
gaagccatcggtatcgttgaagaggtaggcgaagacattacaacacttgttcctggtgac
ttcgttatcgttccatttacacatggttgcggacactgtgatgcctgtcgtgctggcttt
gacggtacttgtgacaaccatccaggctacaccaactggggcaacaactaccagtctcaa
tatattcgtttccactacggtaactgggccttggtcaaaattcctggtcagccaagcgac
tactcagaaggcatgatcaaatctctcttgactctggcagatgttatgccaacaggctac
catgctacgcgtgttgcagatgtcaaacctggtgataaggtggttgtcatcggtgatggt
gcagtggggcaatgtgccgtcattgctgcaaaaatgcggggagcttcgcagattatcatg
atgagccgtcatgctgaccgtcagcaaatggctctggaatcaggggctactgctgttgtt
gctgaacggggcgaggaaggaattgccaaagtccgtgaaattcttggaggtggcgctgat
gctgccctcgaatgtgtcggaacagaagcttctattgaccaagccctcggcgtccttcat
aatggcggtcgcatcggttttgttggtgtgcctcattacaacaaccacgccctcggatca
acttttgctcaaaatatcattatcggtggtggctctgcttctgtcacaacctatgataag
gaaattttgcttgatgctgttctcaaaggcgacatcaacccaggtcgagttttcacccaa
acttacagcctggacaatatcgaccaagcctacaaagacatggccaaccggaaaacgatt
aaagctatgattacggtggattaa

DBGET integrated database retrieval system