KEGG   Streptococcus suis P1/7: SSU1217Help
Entry
SSU1217           CDS       T00936                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssi  Streptococcus suis P1/7
Pathway
ssi00010  Glycolysis / Gluconeogenesis
ssi00071  Fatty acid degradation
ssi00350  Tyrosine metabolism
ssi00625  Chloroalkane and chloroalkene degradation
ssi00626  Naphthalene degradation
ssi01100  Metabolic pathways
ssi01110  Biosynthesis of secondary metabolites
ssi01120  Microbial metabolism in diverse environments
ssi01130  Biosynthesis of antibiotics
ssi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU1217
  Lipid metabolism
   00071 Fatty acid degradation
    SSU1217
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSU1217
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSU1217
   00626 Naphthalene degradation
    SSU1217
Enzymes [BR:ssi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSU1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Shikimate_DH Sacchrp_dh_NADP Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: CAR46539
Position
1246659..1247702
Genome map
AA seq 347 aa AA seqDB search
MKAAIYEKAGKMTVAEIEKPSLQAKDDVIIKVVRACVCGSDLWGYGEDIHHDHGDTNSGH
EAIGIVEEVGEDITTLVPGDFVIVPFTHGCGHCDACRAGFDGTCDNHPGYTNWGNNYQSQ
YIRFHYGNWALVKIPGQPSDYSEGMIKSLLTLADVMPTGYHATRVADVKPGDKVVVIGDG
AVGQCAVIAAKMRGASQIIMMSRHADRQQMALESGATAVVAERGEEGIAKVREILGGGAD
AALECVGTEASIDQALGVLHNGGRIGFVGVPHYNNHALGSTFAQNIIIGGGSASVTTYDK
EILLDAVLKGDINPGRVFTQTYSLDNIDQAYKDMANRKTIKAMITVD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctatttatgaaaaagccggtaagatgaccgttgcagaaatcgaaaaacca
agccttcaagccaaagatgacgtcattatcaaggtcgttcgggcctgtgtctgtgggtcg
gacctttggggctacggagaagacattcaccatgaccacggtgacacaaactctggtcat
gaagccatcggtatcgttgaagaggtaggcgaagacattacaacacttgttcctggtgac
ttcgttatcgttccatttacacatggttgcggacactgtgatgcctgtcgtgctggcttt
gacggtacttgtgacaaccatccaggctacaccaactggggcaacaactaccagtctcaa
tatattcgtttccactacggtaactgggccttggtcaaaattcctggtcagccaagcgac
tactcagaaggcatgatcaaatctctcttgactctggcagatgttatgccaacaggctac
catgctacgcgtgttgcagatgtcaaacctggtgataaggtggttgtcatcggtgatggt
gcagtggggcaatgtgccgtcattgctgcaaaaatgcggggagcttcgcagattatcatg
atgagccgtcatgctgaccgtcagcaaatggctctggaatcaggggctactgctgttgtt
gctgaacggggcgaggaaggaattgccaaagtccgtgaaattcttggaggtggcgctgat
gctgccctcgaatgtgtcggaacagaagcttctattgaccaagccctcggcgtccttcat
aatggcggtcgcatcggttttgttggtgtgcctcattacaacaaccacgccctcggatca
acttttgctcaaaatatcattatcggtggtggctctgcttctgtcacaacctatgataag
gaaattttgcttgatgctgttctcaaaggcgacatcaacccaggtcgagttttcacccaa
acttacagcctggacaatatcgaccaagcctacaaagacatggccaaccggaaaacgatt
aaagctatgattacggtggattaa

DBGET integrated database retrieval system