KEGG   Streptococcus suis P1/7: SSU1369Help
Entry
SSU1369           CDS       T00936                                 

Gene name
gtfA
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ssi  Streptococcus suis P1/7
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1394658..1396106)
Genome map
AA seq 482 aa AA seqDB search
MKIKNQAMLITYSDSLGKNLKDLKKVLEGPLKDVVGGIHILPFFPSSGDRGFAPMDYTKV
DPAFGDWSDIEALSKDYYLMFDFMINHISAKSPYFLDFLEKKDESAYADLFIRYKNFWPN
GEPTQEDVDLIYKRKPRAPYRIATFADGSEEKVWCTFDEQQIDLDVTTETTRRFIQENLE
QLAEHGASIIRLDAFAYANKKIGTNCFFVEPDIWEMLHFPRQLLAPKDVEILPEIHEHYT
IQQKIAEQDYYVYDFALPMLVLHALYSGHVNRLVHWMEICPRKQFTTLDTHDGIGVVDVK
DLLTDEETEETREALYAQGANVKKIYSTEAYNNLDIYQINCTYYSALGNNDQAYLLARVL
QCFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLEEIEQEVQRPVVQSLFKLL
KFRNTSPAFDGEFSVKMLDETSMEIFWNNQDAGVSARLTANLKEKSFEIVEIEEGKITTI
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaatcaagctatgttaattacctattcggatagtttaggcaagaatctt
aaggatttgaaaaaagttcttgaggggccgttaaaggatgttgtgggaggtatccatatt
ctgccgtttttcccatcatcaggtgaccgtgggtttgcgccaatggattatacaaaggtg
gaccctgcatttggagattggtcagatattgaagcactaagcaaagactattacctcatg
tttgattttatgatcaatcatatttcagcaaaatctccttatttccttgattttcttgaa
aagaaagatgaatcagcttatgcggatttgtttattcgttataaaaacttttggccaaat
ggtgagccaacgcaagaagatgttgatttgatttataagcgtaaacctcgcgcaccttat
cgaattgcaacatttgctgatggtagtgaagagaaggtgtggtgtacctttgatgaacag
cagattgatttagatgtgacaacggagacaacccgtcgtttcatccaagaaaatttggaa
cagttggcagagcatggtgcttcgattattcgtttggacgcctttgcttatgccaataaa
aaaatcggaaccaattgtttctttgtggagcctgatatttgggaaatgctccattttcca
cgtcagttattggcaccaaaagatgtagaaatcttaccagaaattcatgaacactacacc
attcagcagaaaattgccgagcaagattattatgtttatgattttgccttgccaatgcta
gttctccacgctttgtattctggtcatgtcaatcgcctggttcactggatggagatttgc
cctcgcaagcaatttacaactcttgatacacatgatggaatcggtgttgtggatgttaag
gatttgctgacggatgaggagacagaggagacccgtgaagccttgtatgcacaaggtgcc
aatgtgaagaaaatttatagtacagaagcctataataatttggatatttatcagattaac
tgtacttattattctgctcttggcaataatgatcaagcttatctattggcgcgtgttctc
caatgctttgcaccaggtattccacagatttattatgttggtttactagcaggcgaaaat
gatattgaacttttagaatcaagtaaggaagggcgcaatatcaatcgccattactatgat
ttggaagaaattgagcaggaagtgcaacggccagttgtacaatccttgttcaaactcctt
aaattccgcaatacaagtccagctttcgacggggagttctctgttaagatgttggatgaa
acaagtatggaaattttctggaataatcaagatgcaggggtgtctgcccgtctaacagca
aacctaaaagaaaaatcctttgaaattgttgaaattgaagagggaaaaattaccacaatt
gagttataa

DBGET integrated database retrieval system