KEGG   Streptococcus suis P1/7: SSU1576Help
Entry
SSU1576           CDS       T00936                                 

Definition
(GenBank) putative peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssi  Streptococcus suis P1/7
Pathway
ssi00300  Lysine biosynthesis
ssi01100  Metabolic pathways
ssi01120  Microbial metabolism in diverse environments
ssi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSU1576
Enzymes [BR:ssi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SSU1576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CAR47274
Position
complement(1581454..1582821)
Genome map
AA seq 455 aa AA seqDB search
MADSKVQAFENDAIIQTYFEKLKVLISKKSIFAQQIGLLDVATYLKDIFEEAGAEVVLDD
SYAAPFVMARFEASVPDAKTLIFYNHYDTVPADADQVWEKGNPFELTISDGYIYGRGVDD
DKGHITARLSALKKYQARQNGHLPVNVIFIMEGAEESASVDLDKYLSKYKEHLIGADLLV
WEQGHRNSLHQLEIAGGNKGIVTFDLQVKSADLDIHSSYGGVIDSASWYLLSALQSMRAA
DGQILVEGIYDQVQEPNERELALVEEFALATSQSMTDIYGLTLPTLIEDRREFLKRLYFE
PSITIQGLSTGYLGQGVKTIIPAQASAKMEVRLVPGLEPHDVLDKIRQHLDKHGFDKVEV
VFTLGEMSYRSDMSHPAIVNVIELAKKLTPEGVAVLPTSPGTGPMHTVFHALGVPIAGFG
LGNANSRDHAGDENVSIADYYSHVELVEELIASYE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagatagtaaagttcaagcatttgaaaatgatgcgattattcaaacctattttgaa
aagttgaaggtcttgatttcaaagaaatccatttttgctcagcagattggtttgctggat
gtggcgacttacttgaaagatatatttgaagaagctggtgcagaggttgttttggatgat
agttatgcagcaccctttgtcatggctaggtttgaggcttcggttccagatgcgaaaaca
ttgattttctacaatcattatgatacagtacctgcagatgccgatcaggtctgggagaag
ggcaaccccttcgaattgaccatttccgatggctatatctatggtcgcggggtagatgat
gataagggccatatcacagctcgtctgtcggccttgaaaaaatatcaagctagacagaat
ggccatttaccagtcaatgtgatttttattatggaaggggcagaagagtcagcctctgtc
gacttggataagtatctttcaaaatataaagaacatttgattggtgctgatttgcttgtc
tgggagcaggggcatcgcaatagcctacatcagctagaaattgctggtgggaataaggga
attgtgaccttcgatcttcaggtcaaatcagctgacttggatattcattcttcctatggt
ggtgtcattgattcggcaagctggtatttattatcagcacttcaatccatgcgggctgca
gatgggcaaattctggtagaaggcatttacgatcaggttcaagagccaaatgagcgtgaa
ttggccttggtggaagaatttgcactggctaccagtcagtctatgacggatatttatgga
ctaacccttccaaccttgatagaagatcgtcgtgagtttctgaagcgtttgtattttgaa
ccatcgattaccattcaaggcttgtcaactggctatcttggtcaaggtgtcaagaccatc
ataccagctcaggcttctgctaagatggaagtccgtctggtacctggattggagccgcat
gatgtattagataagattcgccagcatttggataaacatggttttgacaaagttgaggtt
gtcttcactctaggagagatgagctaccgaagtgacatgtcccaccctgccattgtcaat
gtgattgagttggctaaaaagttgacgccagaaggagttgctgttttgccgacgtcaccg
gggacaggacccatgcatacagtttttcatgccttgggcgtgccgattgcaggatttgga
ttaggaaatgccaacagtcgcgaccatgcaggtgatgaaaatgtcagcatcgctgactac
tatagccatgttgaattagtagaggagttaattgcaagttatgagtaa

DBGET integrated database retrieval system