KEGG   Shigella sonnei 53G: SSON53_00490Help
Entry
SSON53_00490      CDS       T01769                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ssj  Shigella sonnei 53G
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSON53_00490 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSON53_00490 (murE)
Enzymes [BR:ssj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SSON53_00490 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
100455..101948
Genome map
AA seq 497 aa AA seqDB search
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTN
GKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVEQGAT
FCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAI
INADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKAIDVNYHDSGATIRFSSSWGDGE
IESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDY
AHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRT
EEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQR
LDYSDRVTVARLLGVIA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtgccagacgcaccttcgcga
gcactgcgagagatgacactcgacagccgtgtggctgcggcgggcgatctctttgtagct
gtagtaggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgcagaggcgaaagcgaaagatgaggcgaccgacggtgaaatccgtgaa
atgcacggcgtaccggtcatctatctcagccagctcaatgagcgtttatctgcactggcg
ggccgcttttaccatgaaccctctgacaatttacgtctcgtaggcgtaacgggcaccaac
ggcaaaaccacgactacccagctgctggcgcagtggagccaactgcttggcgaaaccagc
gcggtaatgggcaccgttggtaacggtctgcttgggaaagtgatcccgacagaaaatact
accggttccgcagtcgatgttcagcatgagctggcggggctggtggagcagggcgcgacg
ttttgcgcaatggaagtttcctcccacgggctggtacagcaccgtgtggcggcattgaaa
tttgcggcgtcggtctttaccaacttaagccgcgatcaccttgattatcatggtgatatg
gaacactacgaagctgcgaaatggctgctttattctgaacatcattgcggtcaggcgatt
attaacgccgacgatgaagtgggccgccgctggctggcaaaactgccggacgcggttgcg
gtatcaatggaagatcatattaatccgaactgtcacggacgctggttaaaagcgatcgac
gtgaactatcacgacagcggtgcgacgattcgctttagctcaagttggggcgatggcgaa
attgaaagccatctgatgggcgcttttaacgtcagcaacctgctgctcgcgctggcgaca
ctgctggcactcggctatccactggctgatctgctgaaaaccgccgcgcgtctgcaaccg
gtttgcggacgtatggaagtgttcactgcgccaggcaaaccgacggtggtggtggattac
gcgcatacgccggatgcactggaaaaagccttacaggcggcgcgcctgcactgtgcgggc
aagctgtggtgcgtctttggctgtggtggcgatcgcgataaaggtaagcgtccactgatg
ggcgcaattgccgaagagtttgctgacgtggcggtggtgacggacgataacccgcgtacc
gaagaaccgcgtgccatcatcaacgatattctggcgggaatgttagatgccggacatgcc
aaagtgatggaaggccgtgctgaagcggtgacttgcgccgttatgcaggctaaagagaat
gatgtggtactggtcgcgggcaaaggccatgaagattaccagattgttggcaatcagcgt
ctggactactccgatcgcgtcacggtggcgcgtctgctgggggtgattgcatga

DBGET integrated database retrieval system