KEGG   Shigella sonnei 53G: SSON53_06425Help
Entry
SSON53_06425      CDS       T01769                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ssj  Shigella sonnei 53G
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ssj00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SSON53_06425
Enzymes [BR:ssj01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SSON53_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258962..1259948
Genome map
AA seq 328 aa AA seqDB search
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGVIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCEALTDPNAQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEIILWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIGCIS
QKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcataatttaacccgttttccacggttggagtttatcggcgcgccaacgccg
ctcgaatatctgccgcgcttttctgattatctaggacgggaaattttcatcaaacgggat
gacgtcacccccatggcaatgggcggcaataaattacgtaagctagaatttctcgcggca
gatgctctgcgcgaaggtgccgatacgctgattactgccggggtgatccagtctaaccat
gtgcggcagactgccgcagttgcggcgaaactcggtctgcactgtgtggcgctgctggaa
aatcctattggcacaaccgcagaaaactatttaaccaacggcaatcgcttgttgctggat
ctgttcaatacccagattgaaatgtgcgaagcactgaccgatcccaatgcccaactggaa
gagctggcgacgcgagtcgaagcacaaggctttcgcccgtatgtcattccggttggcggt
tctaatgctcttggcgcgctaggttatgtggagagtgcgctggaaatcgcgcaacagtgt
gaaggggcggttaatatttcgtcggtggtagtcgcatcgggcagtgccggaactcacgcc
ggactggctgttgggctggaacacctgatgcctgaaagcgaactgattggcgtgaccgtg
tcgcgttccgttgccgatcagttgccgaaagtggttaacctacaacaggcgattgcgaaa
gaactggagctgaccgcatcagcggaaattatactctgggatgactattttgcacctggc
tacggcgtgccgaacgacgaaggcatggaagcagtgaaattgctggcgcggctggaaggc
attctgcttgatcctgtgtataccggaaaagcgatggcggggctgattggctgtatcagt
cagaaacgcttcaaagatgaagggccgattctgtttattcataccggcggtgcgcctgcg
ctgttcgcctatcatccccacgtttag

DBGET integrated database retrieval system