KEGG   Shigella sonnei 53G: SSON53_08250Help
Entry
SSON53_08250      CDS       T01769                                 

Definition
prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ssj  Shigella sonnei 53G
Brite
Enzymes [BR:ssj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SSON53_08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1565434..1565982)
Genome map
AA seq 182 aa AA seqDB search
MIKLPVKRYAVAAIVALGFSIAPHKLRTSPEAQIRIATWEDCRATPYRDIAGVMTVGCGS
TGHVENRLYTETEVAGRWVNDMQHAENCINQNFSGNAMPQSAFEAMTDAAFNLGCRNLMW
FRDKNRNYHRTTIWKHAQAHNWPDMCNRLTDFVNSGGERSQGLVNRRTDFRAWCLRDTGG
QS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgataaagctgcccgttaaacgttacgccgtagccgccattgtggcgctggggttctcc
attgcccctcacaaactccggaccagcccggaagcgcaaatccgcattgccacatgggag
gactgtcgcgcaacgccttaccgggatattgccggggtaatgaccgtggggtgcggctcg
accgggcatgtggaaaatcgtctgtacaccgaaacggaagtcgccgggcgctgggttaat
gatatgcaacatgcagaaaactgcataaatcagaacttcagcggcaacgccatgccacag
tccgcgtttgaggcaatgacagatgccgcctttaatcttggatgcagaaatcttatgtgg
ttcagggataagaaccgtaactaccaccgcaccactatctggaaacatgcacaggcgcac
aactggcctgacatgtgcaacagactgactgacttcgtgaacagcggcggcgaacgctca
cagggactggttaaccgtcgtactgattttcgtgcatggtgcttacgtgacaccggaggc
cagtcatga

DBGET integrated database retrieval system