KEGG   Shigella sonnei 53G: SSON53_10305Help
Entry
SSON53_10305      CDS       T01769                                 

Definition
phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ssj  Shigella sonnei 53G
Brite
Enzymes [BR:ssj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SSON53_10305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1943005..1943502)
Genome map
AA seq 165 aa AA seqDB search
MSPSLRKAVAVAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDIIGVWTVCHGHTGKDI
MPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGYIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcattacgcaaggctgttgcagttgctattggtggcggggctgttgctata
gcatctgtgttaatcactggcccaggtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatatcattggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgcctggtaaaacgtataccgaagcagaatgcaaagctctcctgaataaagaccttgcc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggctatatcaaaggcgcatgtgaccagctacgtcgctggacatat
gctggcggtaagcaatggaaagggctgatgacccgtcgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system