KEGG   Shigella sonnei 53G: SSON53_10825Help
Entry
SSON53_10825      CDS       T01769                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ssj  Shigella sonnei 53G
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSON53_10825
Enzymes [BR:ssj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SSON53_10825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2017840..2018892)
Genome map
AA seq 350 aa AA seqDB search
MGPLPQKGNMKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVL
ITYADQFHSNDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPCSSDDGFSVIDYHQVASEAG
EWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPQTDLSAVTRPR
ALPLLTPFQMRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAV
GFMWKEPGTSCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAH
MVYQFSLPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHIWMR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacaaaaaggcaacatgaaacagaaaattacggattacctggacgaa
atctacggtggaacatttaccgcaactcatttacagaaacttgtaacgcgtcttgagagt
gcgaaacgattaattacacagcgacgtaaaaaacactgggatgaaagtgatgtcgtgtta
attacctatgccgatcaatttcacagcaatgatttaaaaccattacccacatttaatcag
ttttaccatcaatggctgcaaagcattttttcacatgttcatttattacctttttatcca
tgttcatctgatgatgggttttcggtaattgattatcatcaggtcgccagtgaagcgggg
gagtggcaggatattcagcaactcggtgaatgcagtcatttaatgtttgattttgtctgc
aaccatatgtcggcaaaaagtgaatggtttaaaaactatttacaacagcagccaggtttt
gaagatttttttattgcggttgatccgcaaaccgatctcagcgccgtcactcgcccgcgt
gcgttaccgttattaacgccattccagatgcgcgatcattcaacgcgccatttatggacc
acctttagtgacgatcaaattgacctgaattaccgtagccctgaagtgttgctggcgatg
gtggatgttttactctgttaccttgcgaaaggtgctgagtatgtccgcttggatgccgtt
ggctttatgtggaaagagccgggaacaagctgcatccatctggaaaaaacacatctgatt
atcaaactgttacggtcgattattgataacgttgcgccaggtacagtgatcattaccgag
accaatgttccgcataaagacaacattgcttactttggcgcaggcgatgacgaagcacat
atggtgtaccagttctcgctgccgccactggtgctgcatgcggtgcaaaaacagaacgtt
gaggcgctttgtgcgtgggcgcaaaacctgacactaccttccagcaacaccacctggttt
aacttcctcgcctctcacatatggatgcgttaa

DBGET integrated database retrieval system