KEGG   Shigella sonnei 53G: SSON53_10865Help
Entry
SSON53_10865      CDS       T01769                                 

Definition
4-aminobutyrate transaminase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ssj  Shigella sonnei 53G
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SSON53_10865
   00650 Butanoate metabolism
    SSON53_10865
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSON53_10865
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SSON53_10865
Enzymes [BR:ssj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SSON53_10865
Amino acid related enzymes [BR:ssj01007]
 Aminotransferase (transaminase)
  Class III
   SSON53_10865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2022989..2023528)
Genome map
AA seq 179 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGIST
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgctaccccacgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgctactctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctgaataccggacatcgccaccctgat
ctggtcgcggcggtggagcagcaactgcaacagtttacccacaccgcgtatcagattgtg
ccgtatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcactaccggtgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgccctggcgtgattgcgtttagcggtggcttccacggtcgt
acatatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacatag

DBGET integrated database retrieval system