KEGG   Shigella sonnei 53G: SSON53_14850Help
Entry
SSON53_14850      CDS       T01769                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssj  Shigella sonnei 53G
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ssj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSON53_14850
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSON53_14850
Enzymes [BR:ssj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SSON53_14850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2784980..2786107
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALLIDRLQAIGFTVERMDFADTQNFWAWRGQGET
LAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacaacagcttattcgccgcccttccctgagtcct
gatgacgcaggatgccaggctttgttgattgatcgtttgcaggcgatcggttttaccgtt
gaacgcatggactttgccgatacgcagaatttttgggcatggcgtgggcaaggtgaaaca
ttggcctttgccgggcataccgacgtggtgccgcctggcgacgccgatcgttggatcaat
ccgccgtttgaacccaccattcgtgatggcatgttattcgggcgcggtgcggcagatatg
aaaggctcgctggcggcgatggtggtagcagcagaacgttttgtcgcacaacatcccaac
catacgggacgactggcatttctgatcacctctgatgaagaagccagtgcccacaacggt
acggtaaaagtcgtcgaagcgttaatggcgcgtaatgagcgtctcgattactgtctggtc
ggcgaaccgtcgagtatcgaagtggttggtgatgtggtgaaaaatggtcgtcgcggatcg
ttaacctgcaaccttaccattcatggcgtgcaggggcatgtggcctacccacatctggct
gacaatccagtacatcgcgcagcacctttccttaatgaattagtggctattgagtgggat
cagggcaatgaattcttcccggcgaccagtatgcagattgccaatattcaggcgggaacg
ggcagtaacaacgttattccgggtgaactgtttgtgcagtttaacttccgcttcagcacc
gaactgactgatgagatgatcaaagcgcaggtgcttgccctgcttgaaaaacatcaactg
cgctatacggtggattggtggctttccgggcagccatttttgaccgcgcgcggtaaactg
gtggatgcggtcgttaacgcggttgagcactataatgaaattaaaccgcagctactgacc
acaggcggaacgtccgacgggcgctttattgctcgcatgggggcgcaggtggtggaactc
gggccggtcaatgccactattcataaaattaatgaatgtgtgaacgctgccgacctgcag
ctacttgcccgtatgtatcaacgtatcatggaacagctcgtcgcctga

DBGET integrated database retrieval system