KEGG   Shigella sonnei 53G: SSON53_17805Help
Entry
SSON53_17805      CDS       T01769                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssj  Shigella sonnei 53G
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3343137..3344570
Genome map
AA seq 477 aa AA seqDB search
MKKLTLQKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGCML
AMVPLYPYCCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVITSNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttacagaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctgaccggt
ggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggcaaatactatcca
aaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctatttgccgaa
atgggcttcaaatgttttcggacttccatagcctggacgcgcatttttccaaaaggcgat
gaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttcgcggaa
gtggtgtttgaacgctataagcataaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtttatacc
gagcatgagaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtcgccagc
gccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgtatgctg
gcgatggtgccgctctatccctactgctgtaacccggacgatgtgatgttcgctcaggag
tcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccgtcctat
gtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgatctcgat
gtactgcgcgaaggcacctgcgattatcttggtttcagctattacatgaccaacgcagtg
aaggccgaaggcggcaccggcgatgcgatctctggtttcgaaggcagcgtaccgaacccg
tatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctatgccctt
tgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactacctgcgc
gcccatatcgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatgggctac
acaccgtggggctgcatcgactgcgtatcgttcaccaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaggtgattaccagcaacggcgagaagctttaa

DBGET integrated database retrieval system