KEGG   Shigella sonnei 53G: SSON53_22545Help
Entry
SSON53_22545      CDS       T01769                                 

Definition
cryptic phospho-beta-glucosidase B
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssj  Shigella sonnei 53G
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ssj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSON53_22545
Enzymes [BR:ssj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSON53_22545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4253394..4254452
Genome map
AA seq 352 aa AA seqDB search
MAQAGIRPLVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNE
INMSLHAPFTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLIPEAKIGNMLLGGLVY
PLTCQPQDMLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKYTV
DFISFSYYMTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDPVGLRVLLNTLWDR
YQKPLFIVENGLGAKDSVEADGSIQDDYRIAYLNDHLVQVNEAIADGVDIMEYTSWGPID
LVSASHSQMSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcggggatcaggccgctggtaacgttatcccattacgaaatgccatatggg
ctggtgaaaaactacggcggttgggctaatcgggcggtcatcgatcacttcgagcattac
gcccgcacggtctttacccgctaccaacataaagtagcgttatggctgacgtttaatgaa
atcaatatgtcgttacacgcgccattcacgggcgtggggctggcagaagagagtggcgag
gcggaagtttatcaggcgatccatcatcaactggttgccagtgcgcgggcagttaaagcc
tgtcatagcctgatccccgaagcgaaaatcggcaatatgcttctcggtgggctggtttac
cccctcacctgccagccacaggatatgttgcaggccatggaagagaaccggcgctggatg
ttctttggtgatgttcaggcgcgtggccagtatcccggctatatgcagcgtttcttccgc
gaccacaatatcaccattgagatgactgaaagtgacgcagaagatttaaaatatactgta
gatttcatctcttttagttattacatgactggttgtgtttcccacgacgaaagcattaat
aaaaatgcgcagggcaacatactgaatatgatccccaatccgcatctgaaaagttcagag
tgggggtggcaaattgatccggttggattacgggttctgttaaatacgctttgggatcgt
tatcaaaaaccgttatttattgtcgagaacggattaggcgcaaaagacagcgttgaagcg
gatggttcgatacaggacgattatcgaattgcctatttaaacgatcacctggtacaggta
aatgaagcgattgccgatggtgtggatattatggagtacaccagttgggggccaattgat
ttagtcagtgcatctcattcacaaatgtctaagcgctacggctttatttatgtggatcgt
gatgataatggcgaaggaagcctcacaagaacgcgtaagaaaagcttcggatggtatgca
gaagtgatcaaaacgcgggggctgtcattaaaaaaataa

DBGET integrated database retrieval system