KEGG   Shigella sonnei 53G: SSON53_26145Help
Entry
SSON53_26145      CDS       T01769                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ssj  Shigella sonnei 53G
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ssj00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssj00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ssj03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ssj03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4955630..4956043
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgaccgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgaattacgggcaaacccaacggcacgcgccgcg
ttatggcaacagatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system