KEGG   Streptococcus suis D12: SSUD12_0167Help
Entry
SSUD12_0167       CDS       T02021                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssk  Streptococcus suis D12
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSUD12_0167
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSUD12_0167
   00600 Sphingolipid metabolism
    SSUD12_0167
Enzymes [BR:ssk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSUD12_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171071..173272
Genome map
AA seq 733 aa AA seqDB search
MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETASYQYVREDEYRALTSF
VEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFVYQGHRIYAGRSALKGL
PHLYLDEEGQADSLDIYLLDEQSQTRLVLSYTIFRDYPAVTRSARFEQLGEESVCLNRAL
SMTLCLPDMDYEWLHLDGAWGRERHLQVSPLHQGCQSIYSLKGASSAEHNPFMALKRPTA
DEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERFSWTLDKGEEFQTPEVVMVY
SEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAMSFDFDEETILSLAKEAAGLG
VELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGIIDQVHAMGMKFGLWIEPEMVNK
DSDLYRAHPDWIFHHPQHSRSHGRHQYTLDLSREDVYQNIHDQLHRLLTEHDIDYIKWDM
NRYMTEVFTCTREAERQGETFHRYILNLYRLYDSLIAAFPTVLFESCSSGGARFDPGMLY
YAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHVSASPNQQLGRATPLNTRANVAFFG
SFGYELDLFDCSQEELEEMKEQIAFYKAHRKIFQQGIFTRLKSPFDGEITAWQVQSSDGQ
QVIVGYYRRLATGHPAYQRLYLQGLEEEAVYHLDGEVYTGSQLMHTGLSIRHGDHVGDNK
DFTSCLMVLQKQQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaattatctttcatgaaaagacaaaggaattccatctttacaatgagtttattagc
tatgtgttgacggtcttgcctaatggtcatattggtagtttgtattatggaaagcgtgta
acagaaacagcttcctatcagtacgtgcgtgaagatgagtatcgtgctttgacttccttt
gtagaagacgatgaccgtttcttttcgctccaatatgccaatcctgaatttgcttgttat
ggtacaacggactatttttctccgacttttgagttggtgcagaaggatggtagcagcctg
tcgcactttgtttatcaagggcataggatttatgctgggcgatcggctttgaagggtctt
cctcatctctatctggatgaggagggacaggcagatagtttggatatttatttgttggat
gaacagtcgcagacccgcctggtcttgtcttatacgatttttcgagattatccagcggtg
actcgctctgctcgttttgaacaactcggagaagaatctgtctgtttgaaccgtgccttg
agtatgacactctgtctaccagatatggactatgagtggttacatttggatggggcttgg
gggcgtgagcggcatctgcaagtatcgccgcttcatcaaggttgtcagtctatttacagt
ctcaaaggggctagtagtgcggagcacaatccctttatggctttgaaacgcccaactgcg
gatgagcaacagggagaggtattgggcttctcgctcgtctatagcggaaactttttggcg
caggtggatgtgagttctttccaaaaaacaagagtgagtatgggaatccatcctgagcgt
ttttcttggacattagataagggagaagagttccagacgcctgaggttgttatggtttat
agcgagcatggtttgaatggcatgagccaaacctatcaccgcctcttccaaaaacatctg
gtacgtggctattggcgtgatagagaacggcccgttctcttgaataactgggaagctatg
agttttgattttgatgaggaaacaattctttccttggccaaagaggctgcaggtcttggt
gttgaactctttgtcatggatgatggttggtttggcaagcgaaaccatgaccgagcaggc
ttgggagattggacggtcaatcgtgagaaattaccaagtggcttgacagggattattgac
caagttcatgctatgggaatgaaatttggactttggattgaacctgaaatggtcaataaa
gacagtgatttataccgagcgcatccagactggattttccatcatcctcagcatagtcga
tctcacggacgccaccaatatacgttggatttgtcgagggaggatgtttatcaaaatatc
catgaccaactccatcggctgttgactgagcatgatattgactatatcaagtgggatatg
aatcgctatatgacagaggtctttacatgtacacgggaggcggagcggcaaggtgagacc
ttccatcgctatattctcaatctctaccgcttatatgatagcctgatagcagcttttccg
acagtcttattcgaatcatgttcaagtggtggagctagatttgacccgggaatgctctac
tatgcaccgcaaacctgggtcagcgatgacacggacgccatggaacgcttgaaaatccaa
tatggaacgagcatggtctatcctttaaatagtatgggttgtcatgtgtcagctagtcca
aatcagcagttggggcgagctactccattaaatacacgtgccaatgttgcattctttgga
agttttggctatgaattggatttgtttgattgtagccaagaagagttggaagagatgaag
gagcagattgccttttacaaggctcaccgtaagattttccaacagggtatctttactcgg
ctgaaaagtccattcgatggagaaataacggcttggcaggtccaatcctcggatggtcag
caagtcatcgtgggttattaccgtcggttggcaactggccatcctgcctatcaacgcttg
tacttgcaggggttggaagaggaagcggtctatcaccttgatggagaagtttatactggt
agccaattaatgcatacaggtttgtcgattcgacatggagaccatgttggagacaataag
gactttacttcttgtttgatggtccttcagaaacaacagtag

DBGET integrated database retrieval system