KEGG   Streptococcus suis D12: SSUD12_0175Help
Entry
SSUD12_0175       CDS       T02021                                 

Definition
Beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssk  Streptococcus suis D12
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD12_0175
Enzymes [BR:ssk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSUD12_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180170..181570
Genome map
AA seq 466 aa AA seqDB search
MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYSQEPELFHQQIGPEQTS
TFYEHFQSDLDLLVETGHSIFRTSIQWSRLIPEGIGEVNPQAVEFYRAVFAGIRERGIKL
LVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFGDLVDHWITFNEPIVPVECGY
LGSYHYPCKVDAKAAVIVAYHTQLASSLAVRACHQLHPDHKISIVLNLTPAYPRSQSPED
LQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHGLRPETTEEELTIIKENRVDFLGVN
YYQPLRVQAPSEDGWNGEATFLSQYFQPYDKLDKKINPHRGWEIYEEGLYDIAKNIQENY
GNIEWLVTENGMGVEGEDVFEENGMIQDDYRIKFMEDHLIQLHRGIDEGANCKGYMVWTF
IDCWSWLNAYKNRYGLVSLDLQTQKRTVKKSGYWFKQVSAKNGFIR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgagcaaagagagtatcgttttccagaaggttttttgtggggatcctccact
tcagggcctcaaagtgaaggaagtgtagctggtgatggaaaggggtggaataactgggat
tactggtacagtcaggaacctgagctctttcaccagcaaataggaccggaacaaacatcg
actttctatgaacatttccagtcagatttggatttgttggtggaaacaggtcatagtatt
tttcgcacctctatacagtggtcacgtctgattccggaagggataggcgaggtcaatccg
caagctgtggagttttatagggctgtatttgcaggtattcgagagcgtgggataaagctt
ttggtcaatctttatcacttcgatttgccttatgtcttacaggaaaaagggggctgggaa
aataaggagattgtctgggcctatgaggcttatgctcgccagtgtttcagtctctttgga
gacctggtggatcattggattacctttaatgaacccattgttccagtagaatgtggctat
ctaggaagttatcattatccttgcaaggtggatgcaaaggcagctgtgatcgtagcgtat
catactcaactggctagttctttggctgttcgggcctgtcaccaactacacccagaccac
aaaatttccattgttcttaatcttactcctgcctatccaagaagtcagagtccagaagat
ttacaggcagcgcggattgctgagctatttcaaacgagaagttttttggatccatctgtt
ttgggacaatacccgagggaactggttgacattcttgaaaaacacggtttacgtccagaa
accacagaggaggaattgaccattatcaaagaaaatagggttgacttcctgggggtaaat
tattaccagcccctgcgcgtgcaggctccttcagaagatggatggaacggagaagctact
ttcctatcccaatatttccagccttatgataagcttgacaagaaaatcaatccccataga
ggctgggaaatttatgaagaagggctgtacgacattgccaaaaatatccaggaaaactat
gggaatatcgaatggttggtaactgagaacggcatgggagttgaaggggaggatgttttt
gaagaaaatggcatgattcaggatgactatcggattaagttcatggaagaccatttgatt
cagctccatcgaggtattgatgaaggagcgaactgtaagggctatatggtctggaccttt
attgactgctggtcttggttaaatgcctataaaaaccgatacggtttggtctcgcttgac
ctccaaactcagaagcgtaccgttaaaaaatctggatattggttcaagcaagtgagtgct
aaaaatggttttattagatag

DBGET integrated database retrieval system