KEGG   Streptococcus suis D12: SSUD12_0257Help
Entry
SSUD12_0257       CDS       T02021                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ssk  Streptococcus suis D12
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSUD12_0257
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD12_0257
   00620 Pyruvate metabolism
    SSUD12_0257
   00650 Butanoate metabolism
    SSUD12_0257
  Lipid metabolism
   00071 Fatty acid degradation
    SSUD12_0257
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUD12_0257
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUD12_0257
   00626 Naphthalene degradation
    SSUD12_0257
Enzymes [BR:ssk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUD12_0257
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SSUD12_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
268671..271322
Genome map
AA seq 883 aa AA seqDB search
MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDYIVAKASVAALDKHGEL
AMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDEVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARVVYEAAVAAGAPENCIQW
ITKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAEFKSYKTYFVNKKEKALLEEYCFGV
KANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILAAEVAEIGEKEPLTREKLSPV
IAVLKVDGRAEGLEAARQMVEFHGLGHSAAIHTEDAELAKEFGTIVRAIRVIWNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIKKVGRRRNNMQWFKVPSKTYFER
DSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLDLRRNKVVYQIFSDVEPDPDITTV
YKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPTVDFHDLVQKFMDIRKRAFKFPE
LGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPAH
VTADTGMDVLTHATEAYVSTVANDFTDGLALQAIKLVFENLESSVKNADFVSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGGRFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YKADEKYQDIARLLGLPCSTPEEAVAAYAQAVYDLGERIGIQMNLKAQGIDEKELKEHSR
ELALLAYEDQCTPANPRLAMVDHMQEIIEDAYYGYKERPGRIK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaagtagtatcaccagaagaaaagttggtagaagcgcgcaagcacgtc
gatgagcttgttcaaaaaggtttggttgctcttgatgagttccgtaaacttggtcaagaa
gaagtagactatattgtagcgaaagcttcggttgcggcccttgataaacatggcgaattg
gcaatgcacgcctttgaagaaaccaagcgtggtgtattcgaagacaaggctactaagaac
ttgtttgcttgtgagcacgttgtcaataacatgcgccacacgaaaactgttggtgttatc
gaagaagatgaagtgacaggtttgactttgattgctgagccggtcggtgtcgtttgtggt
atcacaccaacaacaaacccaacttctacagcaatctttaaatcattgattgccttgaag
acacgtaatccaattgtctttgccttccacccatctgcgcaagaatcttctgctcatgca
gctcgtgttgtctatgaagcagctgtggcagctggtgctcctgaaaactgtatccagtgg
attacaaaaccatctatggaagcaacatctgagttgatgaaacatgatggtattgcaaca
atccttgcaactggtggtaacgcaatggtgcgtgcagcttactcttgtggtaaacctgcc
cttggtgtaggtgcaggtaacgttccagcttatgttgaaaaatcagcaaacatccgtcag
gcagcacatgacatcgttatgtctaagtcatttgacaacggtatggtctgtgcgtcagaa
caagcagttatcattgataaagaagtttacgatgagtttgtagcagagttcaaatcttac
aaaacttacttcgttaataagaaagaaaaagctcttcttgaagaatactgcttcggtgtg
aaagctaacagcaagaactgtgctgaaggtaaattgaacgcagacatcgttggtcgccca
gctgcatggatcgctgagcaggccggcttctcagtaccagaaggtacaaacatcttggca
gctgaggttgctgaaatcggtgagaaagaaccattgactcgtgagaaattgtcacctgtt
attgccgtcttgaaagttgatggtcgtgcagaaggtcttgaagcagctcgccaaatggtt
gaattccacggtctcggtcactctgcagctattcatacggaagacgcagaattggcgaaa
gagtttggtacaatcgtacgtgctatccgtgttatttggaactctccatctactttcggt
ggtatcggtgatgtttacaacgcattcttgccatcattgacacttggttgtggttcttac
ggacgcaactcaatcagtgataacgtaagtgctatgaacttgctcaacatcaagaaagta
ggaagacgtagaaataatatgcaatggtttaaagttccttctaaaacatacttcgaacgt
gactctatccaatatctccaaaaatgccgtgacgttgaacgtgtcatgatcgttacagac
cgtgccatggtagaacttggattcctagatcgtatcatcgaacaattggaccttcgtcgt
aataaagttgtttatcaaatcttctcagacgttgagccagatccagacatcacaacggtt
tataaaggtacagaattgatgcgtaccttcaaaccagatacaatcatcgcactcggtggt
ggttcaccaatggatgccgccaaagttatgtggctcttctacgaacaaccaacagttgat
ttccatgacctagttcaaaaattcatggatatccgtaaacgtgccttcaagttcccagaa
cttggtaagaaatctaagtttatcgcgattccaactacctcaggtacaggttcagaagta
acaccgttcgccgtaatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgttgacccagcactcgtattgacagtacctgcacac
gttacagcagatactggtatggacgtattgactcacgctacagaagcatacgtttcaaca
gtagcaaatgactttacagatggtttagcacttcaagctatcaaactagtatttgaaaac
cttgaaagctcagtgaagaatgctgactttgtatcacgtgagaaaatgcacaacgcatca
actatggcaggtatggccttcgccaacgcattcctaggtatttctcactcaatggctcat
aagattggtggacgtttccataccgttcacggtcgtacaaacgctatcttgcttccatac
gttatccgctacaacggtactcgtccagccaagacagctacatggcctaagtacaactac
tataaagcagatgaaaaataccaagacatcgctcgtcttctaggcttgccatgctcaaca
ccagaagaagccgttgcagcatacgcacaagcagtttacgacctcggtgaacgcatcggt
atccaaatgaacttgaaagcacaaggtatcgacgagaaagaactcaaagaacactctcgc
gaattggctcttcttgcctacgaagatcaatgtaccccagctaacccacgtctagcaatg
gttgaccacatgcaagaaatcatcgaagatgcctactacggttacaaagaacgtccaggt
cgcatcaagtaa

DBGET integrated database retrieval system