KEGG   Streptococcus suis D12: SSUD12_0258Help
Entry
SSUD12_0258       CDS       T02021                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssk  Streptococcus suis D12
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSUD12_0258
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUD12_0258
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSUD12_0258
Enzymes [BR:ssk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSUD12_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271737..273221
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDVQNTVSASQAILQGLATDGGLFTPVSIPAVDLDFSVLKDASYQEVAKLIL
SAFLDDFTADELDYCINNAYDSKFDTPVIAPVVKLKGQYNLELFRGSTIAFKDMALSILP
YLMTTAAKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNNVLTD
FFSTGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGNDAAKTAELMEALNTAGQYDIQ
GADADILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQTPTV
IASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVALPPAVDGLETAPVRHNTVVA
AADMQAEVERYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtatatcaatcaacacgcgatgttcaaaatactgtatcggctagtcaggcg
attttgcagggcttggcgactgacggtggtttgtttacaccggtttctattccagcagtt
gacttggatttttctgttcttaaagatgcttcttatcaagaagttgccaaattgattttg
tcagctttcttggatgatttcacggcagatgagctggactactgtatcaataacgcctac
gacagcaagtttgacacgccagttattgccccagtggttaagctaaaaggtcagtacaat
ttggaactcttccgaggttcaaccatcgcctttaaggatatggctctgtccatcctccct
tacttgatgacgactgcggctaaaaagcatggtttggaaaatgagattgtcattttgacc
gcgacttcaggcgatacaggcaaggcggctatggctggctttgcggatgtccctggtacg
caaatcattgttttctacccacgcgatggggtgtctaaggtccaagaattgcagatgacc
acgcagacaggggctaatacgcacgtggtggccattgatggaaactttgacgacgcccaa
accaatgtcaaacatatgttcaatgatgaggcactccgtgccaaattggcggccaagaaa
ctccagttttcatctgccaactccatgaacatcggccgcttggtgccacagattgtgtac
tatgtctatgcctacgctcagctggttaagactggcgagattgcggcgggcgacaaggtc
aactttaccgttccaacaggaaactttggaaatatcttggcggcttattacgccaaacaa
atcggtctgccagttggcaagctcatttgtgcttccaacgataacaatgtcctaaccgac
ttcttctcgactggcgtttacgacaagaaccgtaccttccgcgtgaccaccagtccgtcc
atggacatcttggtgtcctctaacttggagcggttgattttccatctctttggcaatgac
gctgcaaaaacagctgagctgatggaagccttgaacacagctggtcagtatgatattcaa
ggagctgacgcggatatcctctctctctttgctgccgcctttgcgacagaagaagaaacc
gctgcggaaatcaagcgtgtctatgacgagtcagactacattgaagatccacatacggct
gttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaaactccgacagtg
attgcttctacagcaagtccttacaagttcccagtagttgcggttgaggctgtgacaggc
cagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatttcaggtgtagcc
ctgccaccagctgtggacggcttggaaacagcacctgtccgccacaataccgtcgttgca
gctgccgatatgcaggctgaggtagaacgctatttgggtgtttaa

DBGET integrated database retrieval system