KEGG   Streptococcus suis D12: SSUD12_0258Help
Entry
SSUD12_0258       CDS       T02021                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssk  Streptococcus suis D12
Pathway
ssk00260  Glycine, serine and threonine metabolism
ssk00750  Vitamin B6 metabolism
ssk01100  Metabolic pathways
ssk01110  Biosynthesis of secondary metabolites
ssk01120  Microbial metabolism in diverse environments
ssk01230  Biosynthesis of amino acids
Module
ssk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUD12_0258
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSUD12_0258
Enzymes [BR:ssk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSUD12_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AER18597
UniProt: G7SDA7
Position
271737..273221
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDVQNTVSASQAILQGLATDGGLFTPVSIPAVDLDFSVLKDASYQEVAKLIL
SAFLDDFTADELDYCINNAYDSKFDTPVIAPVVKLKGQYNLELFRGSTIAFKDMALSILP
YLMTTAAKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNNVLTD
FFSTGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGNDAAKTAELMEALNTAGQYDIQ
GADADILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQTPTV
IASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVALPPAVDGLETAPVRHNTVVA
AADMQAEVERYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtatatcaatcaacacgcgatgttcaaaatactgtatcggctagtcaggcg
attttgcagggcttggcgactgacggtggtttgtttacaccggtttctattccagcagtt
gacttggatttttctgttcttaaagatgcttcttatcaagaagttgccaaattgattttg
tcagctttcttggatgatttcacggcagatgagctggactactgtatcaataacgcctac
gacagcaagtttgacacgccagttattgccccagtggttaagctaaaaggtcagtacaat
ttggaactcttccgaggttcaaccatcgcctttaaggatatggctctgtccatcctccct
tacttgatgacgactgcggctaaaaagcatggtttggaaaatgagattgtcattttgacc
gcgacttcaggcgatacaggcaaggcggctatggctggctttgcggatgtccctggtacg
caaatcattgttttctacccacgcgatggggtgtctaaggtccaagaattgcagatgacc
acgcagacaggggctaatacgcacgtggtggccattgatggaaactttgacgacgcccaa
accaatgtcaaacatatgttcaatgatgaggcactccgtgccaaattggcggccaagaaa
ctccagttttcatctgccaactccatgaacatcggccgcttggtgccacagattgtgtac
tatgtctatgcctacgctcagctggttaagactggcgagattgcggcgggcgacaaggtc
aactttaccgttccaacaggaaactttggaaatatcttggcggcttattacgccaaacaa
atcggtctgccagttggcaagctcatttgtgcttccaacgataacaatgtcctaaccgac
ttcttctcgactggcgtttacgacaagaaccgtaccttccgcgtgaccaccagtccgtcc
atggacatcttggtgtcctctaacttggagcggttgattttccatctctttggcaatgac
gctgcaaaaacagctgagctgatggaagccttgaacacagctggtcagtatgatattcaa
ggagctgacgcggatatcctctctctctttgctgccgcctttgcgacagaagaagaaacc
gctgcggaaatcaagcgtgtctatgacgagtcagactacattgaagatccacatacggct
gttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaaactccgacagtg
attgcttctacagcaagtccttacaagttcccagtagttgcggttgaggctgtgacaggc
cagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatttcaggtgtagcc
ctgccaccagctgtggacggcttggaaacagcacctgtccgccacaataccgtcgttgca
gctgccgatatgcaggctgaggtagaacgctatttgggtgtttaa

DBGET integrated database retrieval system