KEGG   Streptococcus suis D12: SSUD12_0523Help
Entry
SSUD12_0523       CDS       T02021                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssk  Streptococcus suis D12
Pathway
ssk00010  Glycolysis / Gluconeogenesis
ssk00051  Fructose and mannose metabolism
ssk00562  Inositol phosphate metabolism
ssk01100  Metabolic pathways
ssk01110  Biosynthesis of secondary metabolites
ssk01120  Microbial metabolism in diverse environments
ssk01130  Biosynthesis of antibiotics
ssk01200  Carbon metabolism
ssk01230  Biosynthesis of amino acids
Module
ssk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD12_0523 (tpiA)
   00051 Fructose and mannose metabolism
    SSUD12_0523 (tpiA)
   00562 Inositol phosphate metabolism
    SSUD12_0523 (tpiA)
Enzymes [BR:ssk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUD12_0523 (tpiA)
Exosome [BR:ssk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUD12_0523 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUD12_0523 (tpiA)
  Exosomal proteins of melanoma cells
   SSUD12_0523 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AER18846
UniProt: G7SFD8
Position
526349..527101
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTTEQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagcattcgttgaggctattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttgtggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gttgaattcgtaggtgctcaagtttctgcagctttgaaagacttgactactgaacaagta
gcatcacttgttattgcttacgagccaatctgggcaatcggtacaggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatatggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system