KEGG   Streptococcus suis D12: SSUD12_0523Help
Entry
SSUD12_0523       CDS       T02021                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssk  Streptococcus suis D12
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUD12_0523 (tpiA)
   01230 Biosynthesis of amino acids
    SSUD12_0523 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD12_0523 (tpiA)
   00051 Fructose and mannose metabolism
    SSUD12_0523 (tpiA)
   00562 Inositol phosphate metabolism
    SSUD12_0523 (tpiA)
Enzymes [BR:ssk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUD12_0523 (tpiA)
Exosome [BR:ssk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUD12_0523 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUD12_0523 (tpiA)
  Exosomal proteins of melanoma cells
   SSUD12_0523 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526349..527101
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTTEQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagcattcgttgaggctattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttgtggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gttgaattcgtaggtgctcaagtttctgcagctttgaaagacttgactactgaacaagta
gcatcacttgttattgcttacgagccaatctgggcaatcggtacaggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatatggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system