KEGG   Streptococcus suis D12: SSUD12_0763Help
Entry
SSUD12_0763       CDS       T02021                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ssk  Streptococcus suis D12
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ssk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
777371..778654
Genome map
AA seq 427 aa AA seqDB search
MDTIIVTGSKNGLKGQVEIEGAKNAVLPLLAATVLASQGQTKLTQVPILSDVYTMNNVVR
GLGVRVKFDEETKTIDIDATGKLGSETPYKYVSQMRASIVILGPILARNGYAKVSMPGGC
TIGSRPIDLHLKGLQAMGAKIKQRAGYIEASAENLQGAHIYLDFPSVGATQNLMMAATLA
QGTTVLENAAREPEIVDLAIFLNKMGAKVKGAGTETITITGVEELTGAEHQVVQDRIEAG
TFMVAAAMTGGDVLVKDAVWEHNRPLISKMLEMGVEVTEEAEGIRVRSQVDKLKPVTVKT
LPHPGFPTDMQAQFTALMAIAKGESTMIETVFENRFQHLEEMRRMDLHSEILRDTAIITG
GLALQGAQVMSTDLRASAALILAGLVAEGETIVGKLTHLDRGYYRFHEKLAALGATIERV
SGEDENG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggatacaattattgttacaggtagtaaaaacggtttgaagggacaggttgagattgag
ggggcgaagaatgccgttctgcctttattggcagcaacagttctagcaagtcaagggcaa
accaaattgactcaggttcctattttgtctgatgtctatacaatgaataatgttgtacgt
ggtctgggagttcgtgtgaaatttgacgaggaaacaaagactatcgatattgacgcaaca
ggtaaacttggtagcgaaactccttataagtatgtgagtcaaatgcgcgcctctattgtt
attcttggtccgattttggcacgcaatggttatgctaaggtttctatgccaggaggttgt
acaattggtagccgtccaattgatttgcacttaaaaggtttgcaagctatgggggctaaa
attaaacaacgagctggttatattgaagcgagtgcagagaacttgcagggagctcatatc
tatcttgatttcccaagtgttggggcaacgcaaaatttgatgatggctgcaactctggcg
cagggtacaacggtattagaaaatgcagcgcgagaacctgaaattgttgacttggctatt
ttcctaaacaaaatgggggccaaagttaagggagcaggtacagagacgattacgattact
ggtgtagaagaattgactggcgcagaacatcaagtggtgcaagatcgtatcgaagcgggt
acctttatggtggcagcggcaatgactggtggcgatgtcttggtcaaggatgctgtctgg
gagcacaaccgtccactcatttctaagatgttggaaatgggagttgaggtgacggaagaa
gctgaagggattcgagttcgttcgcaagtggataagctgaaacctgtaacagtaaaaact
ttgccacacccaggtttcccaacggatatgcaggctcaatttacagctctaatggcaatt
gcaaagggtgaatctaccatgattgaaacggtatttgagaatcgtttccagcatttggaa
gaaatgcgtcggatggatttgcattcggaaattttacgagatacagctatcatcacggga
ggacttgctctgcaaggtgctcaggttatgtctactgatttacgagcaagtgccgctttg
attctggctggtttggttgctgaaggtgaaacgattgtaggtaaattaacgcacttagat
cgaggttactatcgttttcatgagaaattagctgctttaggtgcaacgattgaacgtgtg
agtggagaagatgaaaatggataa

DBGET integrated database retrieval system