KEGG   Streptococcus suis D12: SSUD12_0775Help
Entry
SSUD12_0775       CDS       T02021                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssk  Streptococcus suis D12
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssk00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ssk00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790059..791849
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLRKNPSSLDEEAISWIEETIAQMTLDEKIGHLFVNMGSQRTEEYLTGVLNDYKI
AAVRYNPGPAADIWEQNYILQTKSKIPLLIAANTESGGNGAVTDGTKIGDEIKIAATAEP
HYAYEMGKVAGLEAAAVGCNASFAPIMDLSRNWRNPIIANRTWGANVDQVIELSKEYMRG
IMEHGIVPFAKHFPGDGIDERDHHLSFASNPMTKSEWMETFGRIYGEMAEEGLPGIMAGH
IHLPNVEKEMHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMIGMTASLPRR
ELLPTAIEAGCDLFLFFNDPEEDLRWMKEGLENGLLSEERLHDALRRTLGLKAKLGLHLF
EGRRQEIMLPKEEALALIGRDEAKQLAKEVADKAITLVKAKQEGIFPVNPERYKRILLVE
VDGYKGGFGAMINAGKKRAADTLKELLKARGHQVSIWENTEARIAKLPEEERPAAIANVY
ASKRPIAEITDNYDLIINLVDVNSGGTTQRIIWPAAKGTPDQPFYVHEIPTIVVSVQHPF
ALADMPQVATYINAYDGLPVTLEALVAKLVGESSFTGVSPVDAYCGLLDTRIWRGK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagtagatttacggaagaacccttccagccttgatgaagaggctatttct
tggattgaagaaaccattgctcagatgactttggatgaaaaaatcggtcacctctttgtc
aacatggggagccagcggacagaagaatatctgactggagtattaaatgattataagatt
gctgctgttcgttacaatcctggacctgctgcagatatttgggagcaaaactatattttg
cagaccaagtctaaaattcctcttttgattgcagccaataccgaatctggtgggaatggc
gctgttacggacggaacgaaaattggggatgaaatcaagattgctgcgacagccgaacct
cactatgcttatgaaatggggaaagttgcaggacttgaagcagctgcggtaggctgcaat
gcctcctttgcaccgattatggacctaagtcgtaattggcgcaatccaatcattgcaaac
cgaacatggggagctaatgtagaccaagtcattgaattgtccaaagaatacatgcgaggc
attatggaacatggcattgtgccgtttgctaagcatttcccaggcgatggtattgatgaa
cgtgaccatcatctctcttttgcttcgaatcccatgaccaaatctgaatggatggaaaca
tttggacggatttatggtgagatggctgaagaaggtcttccaggtattatggcggggcac
attcatttgccaaatgttgagaaagaaatgcatccagaacgtgaattggatgacatgttg
ccagcttcgctgaataaaaccctcttggatgaattgcttcgtggagaattaggttacaat
ggtgccattgtcacggatgccagtcacatgatcggtatgactgcctctttgccacgtcgt
gaactattgcctacagctattgaggcaggatgtgaccttttccttttcttcaacgatcca
gaagaagatttgcgatggatgaaagaaggattggaaaatggtctgctttctgaggaacgc
ctccatgatgctcttcgtcgtaccttgggcttgaaagctaaactcggtcttcacttgttt
gaaggtcgtcgtcaggaaatcatgttgccaaaagaagaagcgctggctttgattggtaga
gatgaggcgaaacagcttgcaaaagaagtagctgacaaggcgattaccttggtaaaagcc
aaacaagaaggaattttccccgtcaatccagaacgctacaaacggattttgttggtcgaa
gtggatggctataagggtggttttggcgccatgatcaatgctggcaagaagagagcagcc
gatacgctgaaagaactattaaaagctcgaggtcaccaagtatctatctgggaaaatacg
gaggcacggattgccaaattgccagaagaagaaagaccagcagcgattgcaaatgtctat
gcttccaagcgtccaattgccgaaatcacagataactatgatttgattatcaatttagtc
gatgtcaactcaggggggacaactcagcggattatttggccagctgccaagggaacacca
gaccagcctttctatgttcacgaaattccaaccattgttgtctctgttcagcacccattt
gcacttgcagatatgccgcaggttgcaacctatatcaatgcctacgatggcttgcctgtc
actttagaagccttggttgccaaactagtaggagagtcatcctttacaggggtatcgcct
gtagatgcctactgtggtttgctagatacacgtatttggcgaggaaaataa

DBGET integrated database retrieval system