KEGG   Streptococcus suis D12: SSUD12_0776Help
Entry
SSUD12_0776       CDS       T02021                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssk  Streptococcus suis D12
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSUD12_0776
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SSUD12_0776
Enzymes [BR:ssk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSUD12_0776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791860..793584
Genome map
AA seq 574 aa AA seqDB search
MPRLVDLRKKPYCLNEEQIAWVEDTLAHLTDEEKIGQLFVNLFFFGGDAFSGNNLSNQEL
MNRYHIGGARYMNGSPEQVQGLINELQSYSKVPLLVAANCDSGGDGAVKGGTYISSGAQS
EASRDPRIPYLAGLVSAREETALGVNVNFDPCVDIVQNWRNTIVNTRAYGTNADDVIAYT
SAYLEGLTAERDVIQCIKHFPGDGTEERDQHLVLGVNELSPEEWDKSFGLVYRHHIEAGV
EMIMAGHIALPYYQQRLNPTLKDEDILPATLAPELIQDLLKEKLEFNGLVITDASHMLGM
TAAMRREDYVPAAIAAGCDMFLFFNNLEEDFEFMLNGYRKGVITEERLHDALRRILGLKA
KLNLHIKQAEGTLLKSADELAIIGCEEHLAWQREAADKAITLLKDTQKNLPISPETHRRI
RLYYLEGEKEGIMAASTEVVDNLKAALEARGYEVTVNDGTTRIKGKTLQYREEVDLALTV
ANVIGYGAQNNYRIQWKTAMSNEVPWYVHEVPTIFVSLNYTTHLHDVTMVKTAINAYHHN
KNTIESLLDKLEGKDAFYGVPNENVWANKWQAKL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcctagattggttgatttgcggaagaaaccctattgtttgaatgaagagcagattgcc
tgggtagaagataccttggctcatctgactgatgaagaaaaaatcggtcaattgtttgtt
aatctattcttcttcggaggggatgcctttagtggaaataatctgagtaatcaggaattg
atgaaccgatatcatataggtggtgctcgttatatgaatggcagtccggaacaggtacaa
ggactgattaacgagttgcaaagctattcaaaagtacctctcttggttgcagcgaactgt
gactcaggtggagatggagctgtgaaaggaggaacctatatttcctcaggtgctcaatcg
gaagccagtcgggatcctcgtattccctacctagcaggtctcgtatctgcgcgtgaggag
actgcattaggtgtaaatgtcaactttgatccgtgcgtggacattgttcagaactggcgc
aataccatcgtcaataccagagcctacggcacaaatgcggatgatgttattgcttatacc
agtgcctatctagaaggattgactgctgaaagagatgttattcaatgtatcaagcatttc
ccaggagatggtacagaagagcgtgatcagcacctggtcctcggtgtcaatgagctctct
ccagaagaatgggacaagagctttggtcttgtctatcgtcatcatattgaagctggtgtt
gagatgattatggcgggtcatattgccttgccatattaccaacaacgactcaatccaact
ttgaaggatgaagacattttgcccgcaacgctggctcctgaattgattcaagatttattg
aaagaaaaactggaattcaatggcttggtcataacagatgccagccacatgttggggatg
acagcagccatgcgtcgtgaagactacgtacctgcagccattgctgcgggttgcgatatg
ttcttattcttcaataacttagaagaagattttgaatttatgctcaatggctaccgcaag
ggagtgattactgaagaacgccttcatgatgctctccgtcgcattttaggtctgaaagcc
aaactcaatctgcatatcaagcaagcggaaggaaccttactaaaatcagctgatgaattg
gctattatcggctgtgaagagcacttggcttggcaacgtgaagcagcagataaagcaatt
acgctgttgaaagatacacagaaaaatcttccaatcagtccagaaacccatcgcagaatc
cgtttgtattacctagagggtgaaaaagaagggattatggcggcaagtacagaagtggtt
gataaccttaaagctgccctagaggcgcgtggttatgaagtgactgtcaatgatggtacg
actcgaatcaaaggtaaaacgctgcaataccgagaagaagttgatttagccttgactgtt
gccaatgtcattggatatggagcgcagaataattaccgcatccagtggaaaacggccatg
tccaatgaagttccttggtatgtacatgaagttccaaccattttcgtttcactaaactat
acaactcaccttcacgatgttaccatggtcaaaactgctatcaatgcctaccatcataat
aaaaatacgattgaatccctccttgataaattagaaggaaaagatgcattctatggtgtg
ccaaatgagaatgtttgggccaataaatggcaggcaaaactataa

DBGET integrated database retrieval system