KEGG   Streptococcus suis D12: SSUD12_0788Help
Entry
SSUD12_0788       CDS       T02021                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssk  Streptococcus suis D12
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803774..804262
Genome map
AA seq 162 aa AA seqDB search
MKHLAYLSIGGNMGNRQAYLQAALDKLASHSGCQLGLVSNIYETPAWGKTDQADFLNLAC
QVYTDLSAQDFLSVCQNIEQELDRVRIEKWGQRTVDLDIIFWDEEKIQEENLIVPHPYAH
ERAFVLKPLAEIASDYCHPILKKVVSDLLAELGEQKDINIFK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctagcctatctcagtatcggagggaacatgggcaatcggcaagcctattta
caggcagccctagacaaattagccagtcactcaggttgccagcttggcttagtttccaac
atttatgaaactccagcttggggcaagaccgaccaggctgatttcctcaatctagcctgt
caagtgtatactgatttgtctgctcaggattttctaagcgtttgtcagaacatcgaacaa
gagttggaccgagtacggattgaaaaatggggacaacggaccgttgatttggatattatt
ttttgggacgaggagaagattcaagaagagaatctgattgttccccatccctacgcccat
gaaagagcatttgttctcaaacctcttgctgagattgcttctgattactgtcacccaatt
ttgaaaaaagtggtatcggacttgcttgcagaactaggggaacaaaaagatataaacatt
ttcaaatag

DBGET integrated database retrieval system