KEGG   Streptococcus suis D12: SSUD12_0953Help
Entry
SSUD12_0953       CDS       T02021                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssk  Streptococcus suis D12
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSUD12_0953
   00670 One carbon pool by folate
    SSUD12_0953
Enzymes [BR:ssk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SSUD12_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(961338..961850)
Genome map
AA seq 170 aa AA seqDB search
MTKKIVAIWAQDENGLIGKGDRLPWSLPADFAHFKETTTGHTMVMGRITFDGMGKRALPN
RHTIVLTTDKTYQLESEHVTILHSVEDVLDWYNKQEHTLFVLGGGQIFTAFAPYIEALIV
TDIHGQFNGDVYFPKAFPMEKFQLQSANLRPKDEKNPYDFTIKTYERRDG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagattgttgccatttgggctcaagatgaaaatggattgattggaaaaggt
gatagacttccttggtcattgccagctgacttcgctcatttcaaagaaacgacaacaggt
cacacgatggtgatgggacgtataaccttcgacggcatgggtaaacgtgctcttcccaat
cgtcacaccatcgttttgactacagataaaacctatcaactagagagtgaacatgttacc
attttacacagtgtggaagatgtcctagattggtataacaaacaggagcatactctattt
gtgcttggtgggggacaaatttttactgcttttgcaccttacattgaagctttaatagtg
acagatattcacggtcaatttaatggcgatgtgtattttccgaaagcatttcctatggag
aaatttcagctacaaagcgccaatttacgtccaaaagacgagaaaaacccgtatgatttt
acaataaaaacctatgaaagaagagatggttag

DBGET integrated database retrieval system