KEGG   Streptococcus suis D12: SSUD12_1379Help
Entry
SSUD12_1379       CDS       T02021                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ssk  Streptococcus suis D12
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSUD12_1379
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SSUD12_1379
Enzymes [BR:ssk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SSUD12_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1384555..1385631)
Genome map
AA seq 358 aa AA seqDB search
MTEKTIVFKVGTSSLTQENGSLDRIKIARITNQLAQLHQKGYQIVLVTSGSIAAGFRRLG
FDKRPTKIAEKQASAAVGQGLLIEEYTQNLMKDGIVSAQILLTQDDFADARRYQNASQAL
QVLLKQRAIPIINENDTIAIEEIKVGDNDTLSAQVASLLKADLLVLLTDVDGLYTANPNS
DPNAKHLPEIKEITEDLFAMAAGAGSSNGTGGMTTKLQAAQIATKSGVPVFICSSKEDTA
LLQAVTQANRGTLFLADDHAMNQRKQWMAFYARTDAAVEVDAGAVDAMLHQGRSLLATGV
KALEGDFEVGQVVEVYSQADHRLIGKGRVKLSSKDLQDQLANGRAEGVLIHRNDWVSL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaacaattgtatttaaggtcgggacaagttctctgacgcaagaaaatggg
agtttggaccgtatcaaaattgctcggattaccaatcagctggctcagttgcatcagaag
ggctaccagattgtgctggtgacgtcgggctcgatcgctgctggttttcggagattgggc
tttgacaagcgaccgactaagattgcggagaagcaggcttctgcggctgttgggcaaggt
ttgctgattgaggaatacacgcaaaatctaatgaaggacggcatcgtatcggctcagatt
ttgctgacccaggatgattttgcagatgccagacgttatcagaatgcctctcaggccttg
caggtcttgctgaagcagcgtgctattcctattatcaatgaaaatgataccattgccatt
gaggagattaaggtgggagacaatgataccctgtctgctcaggtggcttctctcttgaaa
gcagatctcttggtgctcttgacggatgtggatggactttacactgccaatcccaacagc
gatcccaatgccaaacatttgccagagattaaggaaattacggaagatttgtttgccatg
gcagcaggagcaggctcgtccaacggaacaggtggcatgaccaccaaattgcaggcggcc
cagattgcgaccaagtcaggcgtgcccgtctttatctgctcttcaaaagaggataccgcc
ctcttacaggcggtcacccaagccaatcgtggaacgctctttttagcagatgaccatgcc
atgaaccaacgcaagcagtggatggccttctatgctcggacagacgcggcggttgaagtg
gatgcaggagcggttgatgccatgttgcatcaggggcgcagtttgttagctactggtgtc
aaagccctcgaaggagactttgaagtgggccaggtcgtagaagtttacagccaagcagac
catcgtttgattggtaaaggacgggtcaaactgtcctccaaggacttgcaggaccagttg
gcaaatggcagagcagagggcgtgttgattcaccgcaacgattgggtgagcttatag

DBGET integrated database retrieval system