KEGG   Streptococcus suis D12: SSUD12_1451Help
Entry
SSUD12_1451       CDS       T02021                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ssk  Streptococcus suis D12
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ssk00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ssk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1464746..1466089
Genome map
AA seq 447 aa AA seqDB search
MKINTALGILAGKSSQFILKKLGRGTTLPGKIALKFDKHILDSLAKDYEVVVVTGTNGKT
LTTALTVGILQEAFGEITTNTSGANMITGITATFLSAKKNKNGKKIAVLEIDEASLARVT
DFIKPSLIVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPQATILANGDSPLFNSTTVTNP
VKYYGFATDEHEPRLAHYNTEGVLCPHCHQIIQYKLNTYANLGSYICNNCGFSRPELDYK
LTELKEITNTSSTFAIDGQDYKINIGGLYNIYNALAAVSVAEFFGVSPEKIKAGFDKSKA
VFGRQETFKLGDKDCTLVLIKNPVGATQAIEMMKLAPYDFSLSVLLNANYADGIDTSWIW
DADFEQITQMDIPQVFAGGVRSSEIARRLRVTGYPEDQITETPKLEDIMTLIEQSSSQHA
YILATYTAMLEFRDLLAQRQAVGKEMK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagctttgggtattctagcaggaaaaagttcccagttcattttgaaa
aaactaggacgtggtactaccctgcctggaaaaattgccctcaaattcgataaacatatt
ttagatagtttggctaaggattatgaagtcgttgttgtgacaggtactaacggtaagacc
ctgaccaccgccctgacagttggcatcctccaagaagcctttggagaaattacgaccaat
accagcggcgccaatatgattacagggattacagccacctttttatctgccaagaaaaat
aaaaatggcaagaagattgccgtcttggagattgatgaagccagtctggcccgtgtcacc
gactttatcaagcctagcctgattgtcttcaccaatatcttccgcgaccaaatggaccgc
tatggtgagatttataccacctaccagatgattttggacggggctgccaaggcacctcag
gcaaccattctcgccaacggtgacagcccgcttttcaactcgaccaccgttaccaatcca
gtaaaatactacggttttgcgacggacgagcatgagccacgtctggcccattacaatacc
gaaggcgttctctgcccgcattgccaccagattatccagtacaagctcaatacctacgct
aacttgggtagctatatctgtaacaactgtggctttagccgacctgagctggactacaag
ttaacagagttgaaggaaatcaccaatacttcttctacctttgccattgacggtcaggat
tacaaaatcaacatcggtgggctttacaatatctataatgccctagcagctgtcagcgtg
gcagaatttttcggcgtatctccagagaaaatcaaggctggttttgacaagtccaaggca
gttttcggtcgccaagaaacctttaaattgggtgacaaggattgtaccctggtcttgatt
aaaaacccggtcggtgcaacccaggccattgaaatgatgaaactggctccttacgatttt
agcctgtctgtccttctcaatgccaactacgctgatggaattgataccagctggatttgg
gacgccgactttgaacaaatcactcaaatggacattccacaagtctttgcaggcggtgtt
cgctcgtctgaaattgcccgtcgcctccgtgtgactggctatccagaggaccagattact
gaaacaccaaaactggaagacatcatgaccttgattgagcagtccagcagtcagcatgcc
tatatcctcgcaacctatacggctatgctggaattccgtgacttgctggctcaacgccaa
gctgttggaaaggagatgaaataa

DBGET integrated database retrieval system