KEGG   Streptococcus suis D12: SSUD12_1509Help
Entry
SSUD12_1509       CDS       T02021                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ssk  Streptococcus suis D12
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSUD12_1509
Enzymes [BR:ssk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SSUD12_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1521247..1522695)
Genome map
AA seq 482 aa AA seqDB search
MKIKNQAMLITYSDSLGKNLKDLKKVLEGPLKDVVGGIHILPFFPSSGDRGFAPMDYTKV
DPAFGDWSDIEALSKDYYLMFDFMINHISAKSPYFLDFLEKKDESAYADLFIRYKNFWPN
GEPTQEDVDLIYKRKPRAPYRIATFADGSEEKVWCTFDEQQIDLDVTTETTRRFIQENLE
QLAEHGASIIRLDAFAYANKKIGTNCFFVEPDIWEMLHFPRQLLAPKDVEILPEIHEHYT
IQQKIAEQDYYVYDFALPMLVLHALYSGHVNRLVHWMEICPRKQFTTLDTHDGIGVVDVK
DLLTDEETEETREALYAQGANVKKIYSTEAYNNLDIYQINCTYYSALGNNDQAYLLARVL
QCFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLEEIEQEVQRPVVQSLFKLL
KFRNTSPAFDGEFSVEMLDETSMEIFWNNQDAGVSARLTASLKEKSFEIVEIEEGKITTI
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaaccaagctatgttgattacctattctgatagtttaggtaagaatctc
aaggatttgaaaaaagttcttgagggaccattaaaggatgttgtgggaggtattcacatt
ctaccattcttcccatcatcaggtgaccgtgggtttgcaccaatggattatacaaaggtg
gaccctgcatttggagattggtcagatattgaagcactaagcaaagactattatctgatg
ttcgattttatgatcaatcatatttctgcaaaatctccttatttccttgattttcttgaa
aagaaagatgaatcagcttatgcggatttgtttattcgctataaaaacttttggccaaat
ggtgagccaacgcaagaagatgttgatttgatctataagcgtaaacctcgtgctccatat
cgaattgcaacatttgctgatggtagcgaggagaaggtatggtgtacctttgatgagcaa
cagattgacttggatgtgactacagagacaacacgccgtttcatccaagaaaatctggaa
caattggcagaacatggtgcttcgatcattcgtttggacgcctttgcttatgccaataaa
aaaatcggaaccaattgtttctttgtggagcctgatatttgggaaatgctccattttcca
cgtcagttattggcaccaaaagatgtagaaatcttaccagaaattcatgaacactacacc
attcagcagaaaattgccgagcaagattattatgtttatgattttgccttgccaatgctg
gttctccacgctttgtattctggtcatgtcaatcgcctggttcactggatggagatttgc
cctcgcaagcaatttacaactcttgatacacatgatggaatcggtgttgtggatgttaag
gatttgctgacggatgaggagacagaggagacccgtgaagccttgtatgcacaaggtgcc
aatgtgaagaaaatttatagtacagaagcctataataatttggatatttatcagattaac
tgtacttattattctgctcttggcaataacgatcaagcttacctattagcgcgtgttctt
caatgttttgcaccaggtatcccacagatttactatgttggtttacttgcaggtgaaaat
gatattgaacttttagaatcaagcaaggaaggtcgcaatatcaatcgccattactatgat
ttggaagaaattgagcaggaagtgcaacggccagttgtacaatccttgttcaaactcctt
aaattccgcaatacaagtccagctttcgacggggagttctctgttgagatgttggatgaa
acaagtatggaaattttctggaataatcaagatgcaggggtgtctgcccgtctaacagca
agcctaaaagaaaaatcctttgaaattgttgaaattgaagagggcaaaattaccacaatt
gagttataa

DBGET integrated database retrieval system