KEGG   Streptococcus suis D12: SSUD12_1640Help
Entry
SSUD12_1640       CDS       T02021                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssk  Streptococcus suis D12
Pathway
ssk00520  Amino sugar and nucleotide sugar metabolism
ssk01100  Metabolic pathways
ssk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSUD12_1640
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SSUD12_1640
Enzymes [BR:ssk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSUD12_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 CCB1
Motif
Other DBs
NCBI-ProteinID: AER19914
UniProt: G7SEK7
Position
complement(1636560..1637702)
Genome map
AA seq 380 aa AA seqDB search
MRKRFNVLGTSITCLLFIGLMLGLFFLGDRTQKEQTKDTTTSSSQEISARDKVIANYLEQ
MTLEEKVGQMIFARMPSAGQTEALETYHFGGYILFASDFEGKTLEQVKEEIASYQSLSKV
PLLMASDEEGGTVTRISQLLETPFASPLELYQAGGIEAILSDAKQKTSLLKEEGIYAGFF
PVADLSTDPSSFIYDRTIGQDAKTTADYIGQLVTLLKEEQFASTLKHFPGYGDNADSHTD
LVYDNRSLEDLRANDFLPFKAGIEAGADSIMVSHNIVPAIDNVPSSISPEINKILRNELG
FEGVIMTDDFDMQGLVQFVDQDTGALQTIQAGTDMILSSSYASQIPYIIEQVKSGTITEE
RIDQSVKRILGMKYDLGLIK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaagatttaatgtgttagggacaagtatcacttgtctcttgtttattgggctt
atgctaggcttgttctttttgggagatcgaacacaaaaggagcaaaccaaagatacaacg
acatcgtctagccaagaaatatctgctagggacaaagtgattgcaaattatctagaacag
atgaccttagaagaaaaggtcggacagatgatctttgctcggatgccatctgcaggacaa
actgaggcattggaaacctatcattttgggggctatatcttatttgcaagtgattttgaa
ggtaagacactggagcaagttaaagaagagattgcttcttatcaatcactttcaaaagtg
ccactattaatggcttcagatgaggaaggtgggacggtaacgaggattagtcaacttctg
gagacaccttttgcatcgcctttggaattgtaccaagctggtggcattgaggcgattttg
tcggatgccaagcagaagaccagtcttttaaaggaagagggaatctatgcaggcttcttc
ccagttgcggatttatccaccgatccatcatcttttatctatgataggactattggacag
gatgcgaaaaccactgcagactatattggtcaattggttacattgttgaaagaggaacaa
tttgcttcgaccctgaagcatttcccaggttatggggacaatgctgattcgcatacggat
ttggtctatgacaaccgaagtttagaagatttgcgtgccaatgattttctcccctttaaa
gctgggattgaagcaggtgcagactctatcatggttagccacaatatcgtacctgccatt
gataatgtcccatcatccatttcacctgaaatcaataaaatccttcggaatgagcttggt
tttgagggtgtcattatgacggatgattttgatatgcagggcttggtccaatttgtagat
caagatacaggtgccttgcagaccattcaagctgggacagatatgatattatcttcaagt
tatgccagtcaaattccttatattatcgaacaagtaaagtctggtacaattacagaggag
cggattgaccaatccgtcaaacggattttgggaatgaaatacgatcttggcttaatcaaa
taa

DBGET integrated database retrieval system