KEGG   Streptococcus suis D12: SSUD12_1743Help
Entry
SSUD12_1743       CDS       T02021                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssk  Streptococcus suis D12
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssk01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ssk00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1725441..1726808)
Genome map
AA seq 455 aa AA seqDB search
MADSKVQAFENDAIIQTYFEKLKVLISKKSIFAQQIGLLDVATYLKDMFEEAGADVVLDD
SYAAPFVMATFKASVPDAKTLIFYNHYDTVPADADQVWEKGNPFELTISDGYIYGRGVDD
DKGHITARLSALKKYQSRQNGHLPVNVIFIMEGAEESASVDLDKYLSKYKEHLIGADLLV
WEQGHRNSLHQLEIAGGNKGIVTFDLQVKSADLDIHSSYGGVIDSASWYLLSALQSMRAA
DGRILVDGIYEQVQEPNERELALVEEFALATSQSMTDIYGLTLPTLVEDRREFLKRLYFE
PSITIEGLSTGYLGQGVKTIIPAQASAKMEVRLVPGLEPHDVLDKIRQHLDKHGFDKVEV
VFTLGEMSYRSDMSHPAIVNVIELAKKLTPEGVAVLPTSPGTGPMHTVFHALGVPIAGFG
LGNANSRDHAGDENVSIADYYSHVELVEELIASYE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagatagtaaagttcaagcatttgaaaatgatgcgattattcaaacctattttgaa
aagttgaaggtcttgatttcaaagaaatctatttttgctcagcagattggtttgttggat
gtggcgacttatttgaaagatatgtttgaagaggctggggcagatgttgttttagacgac
agctatgccgcaccatttgtcatggcaacgtttaaggcttcagtgccagatgcgaaaaca
ttgattttctacaatcattatgatacagtacctgcagatgccgatcaggtctgggagaaa
ggcaaccccttcgaattgaccatttccgatggctatatctatggtcgcggggtagatgat
gataagggccatatcacagctcgtctgtcggccttgaaaaaatatcagtctagacagaat
ggccatttaccagtcaatgtgatttttattatggaaggggcagaggagtcagcttctgtt
gacttggacaaatacctttcaaaatataaagaacatttgattggtgctgatttgcttgtc
tgggagcaagggcatcgcaatagcctacatcagctagaaattgctggtggaaataaagga
attgtgacctttgatcttcaggtcaaatcagctgacttggatattcattcttcctatggt
ggtgtcattgattcggcaagctggtatttattatcagcacttcaatccatgcgggctgca
gatggacgaatccttgtagatggcatttacgagcaagtgcaagagccaaatgagcgtgaa
ttggccttagtggaagaatttgcactggctaccagtcagtctatgacggatatttatgga
ctaacccttccaaccttggtagaagatcgtcgtgagtttctgaaacgtttgtattttgag
ccatcgattaccattgaaggcttgtcaactggctatcttggtcaaggtgtcaagaccatc
ataccagctcaggcttctgctaagatggaagtccgtctggtacctgggttggagccgcat
gatgtattagataagattcgacagcatttggacaaacatggttttgacaaagttgaggtt
gtcttcactctaggagagatgagctaccgaagtgatatgtcgcaccctgccattgtcaat
gtgattgagttggctaaaaagttgacgccagaaggagttgctgtcttgccgacgtcaccg
gggacaggacccatgcatacagttttccatgccttgggcgtgccgattgcaggatttggt
ctaggaaatgccaacagtcgcgaccatgctggtgatgaaaatgtcagcatcgctgactat
tatagccatgttgaattagtagaggagttaattgcaagttatgagtaa

DBGET integrated database retrieval system