KEGG   Streptococcus suis D12: SSUD12_2015Help
Entry
SSUD12_2015       CDS       T02021                                 

Definition
glucose-1-phosphate-uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssk  Streptococcus suis D12
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSUD12_2015
   00052 Galactose metabolism
    SSUD12_2015
   00500 Starch and sucrose metabolism
    SSUD12_2015
   00520 Amino sugar and nucleotide sugar metabolism
    SSUD12_2015
Enzymes [BR:ssk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSUD12_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2020566..2021465
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFKILENQEPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagctgttatcccagctgcaggtttgggaacacgtttcttacct
gctactaaggcacttgccaaagaaatgttgccaatcgttgacaaaccaaccatccaattt
atcgttgaagaagccctccgttcaggtattgaagatattttggtggtcactggtaagtca
aaacgttctatcgaagaccactttgattcaaactttgaattggaatacaacctcaaagaa
aaaggcaaaaatgatttgttgaaactggttgatgagacaacaggtattcgactacacttc
attcgtcaaagccatccacgtggacttggtgatgctgttcttcaagcaaaagcctttgtc
ggaaatgagccatttgttgtcatgctcggcgatgacttgatggacatcacagatacaaaa
gctgtcccattgaccaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgttatgcctgttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagat
gcaccatctgaccttgccatcatcggtcgatacttgttaacgcctgaaatcttcaagatc
ttggaaaatcaagaaccaggtgccggcaatgagatccagttgacagatgccattgatact
ctgaacaaaacacaacgtgttttcgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttgatcgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system