KEGG   Streptococcus suis D12: SSUD12_2097Help
Entry
SSUD12_2097       CDS       T02021                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssk  Streptococcus suis D12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2109926..2111446)
Genome map
AA seq 506 aa AA seqDB search
MKVRQSGVLMHISSLPGKYGIGSMGQSAYEFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDILIDKGWLAAEDLHGVDFGQNPTEVDYAAIFYARRPLLEKVVANMK
AQGLPEDYWMFLGENDFWIHTFAEYMAIKEHFDLKPWTEWEDQGARLRYHDTLEYYRHLL
ADRIDYHRITQYLFFSQWKALKAYANAKGVEFVGDMPIYIAADSADMWANPHFFKTDEEG
KPSVVAGCPPDAFSEIGQLWGNPIYDWEAMKHDGFTWWVARLRESFKIYDMVRIDHFIGF
ASFWEIPAGEETAVNGYRVEAPGFELFDTIKRELGDLNIIAEDLGSVTDKVIQLRDTTGF
PGMKVLQFAFDPEGDSIEMPHNHPNNVVAYTGTHDNDTILGWYENETTKESRAFLDKYSN
RREGETVSHALFRLLFGSPAFMAVATMQDLLGLDGSARMNLPNTLGGNWTWRMTADQLTP
EIEAELLDLTETYRRVNVHLVDEKSE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagacagagtggtgtgctgatgcacatttcatcattaccaggaaaatatgga
attggttccatgggacaatcggcctatgaatttgttgattttttggtaagaactaagcaa
cgctattggcaaatcttacctttgggaacaaccagttatggagattctccttaccagtca
ttttcagcttttgcagggaatactcattttattgatttcgatatattgattgataaaggc
tggctagcagcagaggatttacacggtgttgactttgggcagaatcctacagaggtagat
tatgcagccattttttatgctcgccgtccattactggagaaggtagttgccaacatgaag
gcacaaggcttgccagaagattactggatgttcttaggggagaatgacttttggattcat
acctttgcggagtatatggctataaaagagcattttgatctcaaaccttggacagagtgg
gaagatcaaggggcgcgcttacgttaccacgataccttggaatattatcgtcacttgttg
gcagatcgaattgattatcaccgcattacacaatatttattcttttcacaatggaaggcc
ttaaaggcttatgccaatgccaaaggtgttgagtttgttggggatatgccgatttatatc
gcggctgattctgctgatatgtgggctaatccacatttctttaaaacggatgaagaaggc
aaaccgagtgtggttgcaggatgcccaccagatgccttttcggaaattggtcagctttgg
ggcaatccgatttatgattgggaagcgatgaagcatgatggatttacttggtgggttgct
cgtttacgtgaatcctttaagatatacgatatggtacgtatcgaccactttatcggcttt
gcctccttctgggaaattccagcgggtgaagaaacagctgtaaatggctatcgtgtcgaa
gcaccaggttttgaattatttgatacaatcaaacgtgaactcggagacttaaatatcata
gctgaggatttgggctctgtgacagacaaggtcatccaattacgtgatacaacaggtttt
cctggtatgaaagtcctgcaatttgcctttgaccctgagggcgacagcattgaaatgccg
cataaccatcctaataatgtggtggcatatacgggaacccatgacaatgatacgattctt
ggctggtacgaaaatgaaacaacgaaagaatcgcgtgcattcttagataagtacagcaat
cgtcgtgagggcgaaacggtcagtcatgctcttttccgcctgctctttggttcacctgcc
tttatggcggtggctactatgcaggacctacttggtttggatggttcggctcgcatgaac
ttgccaaatacacttggtggtaactggacttggagaatgacggcagatcaattgacacca
gagattgaagcggaattgcttgaccttacagaaacctatcgtcgggttaatgtgcatttg
gttgatgaaaagtcagaataa

DBGET integrated database retrieval system