KEGG   Sclerotinia sclerotiorum: SS1G_00059Help
Entry
SS1G_00059        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ssl04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MSSPAPLLRPPIPGSRQNGGARTPRLGLAIPPSLNIKPVNAPATKGLTLQMPGSMPARPS
LPRLQLATPMGSNATPYEQSGRNPTAPGQSASGGSESSAAHSRSGSFGPMDGKGSGPTSA
GSQYSAFSLASQYGLSKPQGTPDPSSAVGSLYSERSEGGVGMERDGSMNGLEAFDKLSLE
KGRTLDVEDLDDDGWRIASMEKRIEELGSLGEGAGGAVTRCMLKGGKTVFALKIITTNPD
PDVKKQIVRELGFNKGCDNEHICRYYGAFVEPSTATISIAMEFCEGGSLDSIYREVKKLG
GRTGEKVLGKIAEGVLNGLTYLHGKKIIHRDIKPSNILLCRDGQVKLCDFGVSGEFGTKG
DANTFIGTSYYMAPERITGQSYTITSDVWSTGVTLLEVAQHRFPFPADGSEMQPRAGLID
LLTYIVRQPIPKLKDEPDAGIKWSDSFKYFIECCLEKDPTRRASPWRMLEHPWMVEMRGK
RVNMAHFLATVWGW
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccagcaccattattacgtcctcccattcccggtagtcgacaaaatggcggc
gcaaggacacctaggttgggtttggctataccaccttctctaaacattaagcctgtcaat
gctcccgcaacaaaaggccttacactacaaatgcctggctccatgcctgcacgaccttca
ctgcctcgattacaattagccacaccgatgggaagtaatgctacgccatatgaacaatct
ggaaggaatccaactgctccagggcagtctgcaagtggagggagtgaaagtagtgcggca
cattcgagatcagggagctttggaccaatggatgggaagggaagtggtccaacatctgca
ggctcacaatactctgcattctcattagcatcgcaatatggattgagcaaaccgcaagga
acaccagatccctcgtcagccgtcgggtcgttatactcggaaaggagtgaaggaggtgtt
ggtatggaaagggatggcagcatgaatggccttgaggcattcgataaactgagtttagaa
aaaggacgaacactagatgttgaagacttagatgatgatggatggcggatagcaagtatg
gagaagaggatcgaggagcttgggagtttgggagagggagcaggaggtgcagtaactagg
tgtatgctgaaaggtggaaagactgtctttgctctgaagatcattaccacaaatcccgat
cccgatgtgaaaaaacagatcgtccgtgaattaggtttcaacaaaggttgtgataacgag
cacatctgtcgctactatggggctttcgtcgaaccctcaacggctaccatttccattgcc
atggagttttgtgaaggtggttctctcgactcaatatatcgtgaagtaaagaaacttggt
ggccgtactggtgaaaaggttctcggaaagattgctgaaggtgtcctgaacggtctgacc
tatctccatggaaagaagattattcaccgagatatcaaaccctccaatattctcctctgt
cgcgatggccaggtaaaactatgtgatttcggtgtcagtggtgagttcggtaccaagggc
gacgcaaacacctttatcggaacatcttactacatggcgcctgaacgtattactggtcaa
tcgtacactatcacttccgacgtatggtctactggtgtcacccttttggaggtagctcaa
catcgcttcccattcccagcagatggatcagaaatgcagcctcgagctggattgattgat
ctcctaacatacattgttcgacaacctattccaaaattgaaggatgaaccggatgctggt
atcaaatggagtgacagtttcaagtacttcatcgagtgctgtctcgaaaaagatcctact
cgtcgcgcctctccttggcgaatgttggagcacccatggatggtcgaaatgcgtggcaaa
cgtgtgaatatggcacacttcttagccacggtatggggctggtaa

DBGET integrated database retrieval system