KEGG   Sclerotinia sclerotiorum: SS1G_00098Help
Entry
SS1G_00098        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SS1G_00098
Protein kinases [BR:ssl01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   SS1G_00098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 842 aa AA seqDB search
MARDYNGNPQAQPPTGFTYDQYPGALGSHPQSLASSPATPQMTDGNGDVAMQDSGDQYNM
KYPMRPHHQQHLSGNQRLSHQSPQEPSAAAQRYSPMETLSPTSPYGAAQQQNSNQYMSPP
GAGSRKSPSKNASYSSPNSYYTNRQQLPPIQPYAPNSNNESYPTSATQQLNAVFGNDAKV
PRRPVPQSAQGPPGRGPVPEFTKIRSLSDLQPKVNAQPAFRRANPEGGFISPLQALTSHL
PSTYRICNPSFKYESSRNPRRVLTKPSKGVKNDGFDNEDSDYILYVNDILGSEETTHKNR
YLILDVLGQGTFGQVVKCQNLKTQEVVAVKVVKNRTAYFNQSMMEVSVLDLNQFRGLSTT
LVRVFAQQLLNGLSLLNKARLIHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYI
QSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGNPPN
WMLEMGKQSGDFFEKRHDVDDYGRRTYHLKSMEQYSREHGTKEQPSKKYFQATTLPEIIR
SYAMPRKNMKPNEVEREMSNRVAFIDFVRGLLNINPLERWSPQQAKLHPFITQQKFTGPF
VPPTNLKSSAINRSPAPGTTQQQQAEALSNQRAQAAQAQAHSQAQSAAHASYNSSVPVNS
YGQVPQNQQHPPMYNNMYTPNSNHQAPHQTSHQASHQAAPPPYPTQQGYNQMGMMGQPSA
QMPPAQYGAGPSQQQPSLYQQATVRSGRQRASTMEVQQGGIPVTIQRVASHLDPSQPIRL
QPSPAYYPPPPDGVPDGNPGSARRRGSRAAQGGQAPTRNRDFIRNLEDRTLEEGFMGQSQ
YH
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggctagagattataatgggaacccccaagcccaacctccaacaggttttacatacgat
caatacccaggagctttaggatcacatcctcaatctctggcaagttctcctgctacccct
caaatgacagatgggaatggagatgtggccatgcaagactctggagatcaatacaacatg
aagtatcccatgcgccctcatcatcaacaacacctttcgggaaatcagaggttatctcat
caatcgccgcaagagccatctgcggccgctcagcgttattctcccatggagactttatcg
ccaacctcaccatatggcgcggcacaacagcaaaactcgaatcagtacatgtcaccaccg
ggggctggcagcagaaaatctccttcgaagaatgcatcgtattcttccccgaattcgtat
tatactaatcgtcaacaattaccacccattcagccatatgctcctaattctaacaatgaa
tcatacccaacctctgcgacccaacaactgaatgctgtgtttggtaatgacgcaaaggtt
cctcgacgtccagtaccccaatcggcgcaaggtccacctggaagaggaccagttcctgaa
tttacaaaaattcggtctctatctgacctgcagccaaaggttaatgcgcaaccggctttt
cgcagagctaatccagaaggcggattcataagtcctctccaagctctaacgagccatctc
ccctctacatatcggatatgcaaccctagcttcaaatacgaatcatcgcggaatccacgt
agagtgctcaccaaaccaagcaaaggtgtcaagaatgacggcttcgataacgaagatagt
gattatatactttatgtgaatgatattctggggtctgaggaaactactcataaaaaccgc
tatctcatcctagatgttctgggtcaaggcacctttggccaagttgtcaaatgtcagaat
ctgaaaacccaggaagttgtggctgtaaaggtggttaaaaacaggaccgcgtacttcaac
caaagtatgatggaggtttctgttctagacctgaaccaattcagaggtttgagtaccaca
cttgtgcgagtctttgcacaacaacttctgaatggactgagcttgctgaataaagctcga
ctcattcattgcgacttgaagccggaaaacattctgctcaagaaccttgagagccctatc
atcaaaattattgattttggatcagcctgcgacgaacgtcaaacagtctacacatacatc
cagtcgagattttacagatcccccgaggtactactcggcctaccatattcatcagctatc
gatatgtggtcactgggctgtattgttgttgagttgttcttgggtcttccactattccca
ggatcttcggagtacaaccaagtctctagaatagttgagatgctgggtaacccaccgaat
tggatgcttgagatgggaaaacaatctggagatttcttcgagaagaggcatgatgtggat
gattatggcagaagaacatatcatctcaaatccatggagcaatattcccgcgaacatgga
acaaaggagcaaccaagtaaaaagtacttccaagctaccactcttccagaaatcatccgc
tcatacgcaatgccgcgaaagaacatgaagccaaacgaagtcgagcgagaaatgagcaac
cgggttgctttcattgattttgtccggggcttgcttaatatcaatcctctagagcgctgg
tcaccacaacaggctaagttacatccatttatcactcagcagaagttcacgggtcccttc
gttccaccaacgaatttgaagtcgagtgccatcaatagatctccggccccaggaactaca
caacagcaacaggccgaagcattaagcaatcaacgagcacaggccgcgcaagcgcaagct
cactcacaggctcagtccgcagctcatgcgtcatacaattcgagtgtgccggtcaactct
tatggccaggtaccacaaaaccagcagcacccaccaatgtacaacaacatgtacacaccg
aactccaaccaccaggctcctcaccaaacctcacaccaagcctcacaccaggcagcacca
cctccataccccacgcagcaaggttataaccaaatgggaatgatgggccaaccatcagca
cagatgccaccggcgcaatatggagctggcccgtcacagcaacaaccaagtctctaccag
caggctacggtaagatctggaaggcaacgtgcttcgacaatggaggttcaacagggaggt
atacccgtgacgatacaaagagttgctagtcatcttgatcctagtcaacctattcgttta
caacctagtcctgcatactatccacctccaccagatggagttcctgatggcaatcctgga
agcgcacgaagaagaggaagcagagctgctcaaggtgggcaagcacccacccgaaatcga
gacttcattcgaaatctggaagatcgaacattggaggagggtttcatgggacagagccaa
tatcactga

DBGET integrated database retrieval system