KEGG   Sclerotinia sclerotiorum: SS1G_00106Help
Entry
SS1G_00106        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ssl00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:ssl00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MSSISSARYGKDNVRVYKVERDEQTGTQTVTEMTVCVLLEGAIDVSYTKADNSVVVATDS
MKNTVYIKAKEHPVTPPELFASILGTHFIDTYPHLTAANIKIITHRWTRMTIDGKPHPHS
FYRDGNETRNVEAVIKRGKGIDIRSGIVGLLVLKSTGSQFHGFVRDEYTTLPEVWDRILS
TDVDCGWAWKTFAGLDAVKEAIPKFDKAFDDARNITMKTFAEENSPSVQNTMYKMCNSIL
ETVPEVEAVDYSLPNKHYFEVDLSWHKGLKNTGKDAEVYAPQSGPNGLINVTVTRSPASP
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatatcttcagcacgatatggcaaggataatgtccgcgtctataaggtagag
agagatgagcaaaccggaactcaaacagtcacagaaatgactgtttgtgtattactggaa
ggtgctatcgatgtatcatacacaaaagccgacaacagtgttgtggttgcaaccgattcc
atgaagaatacagtctatatcaaagccaaggaacatccagttactccacctgagcttttt
gctagcattcttggaactcactttatcgatacctaccctcatcttaccgcagccaacatc
aaaatcatcactcacagatggacacgaatgactattgatggcaaaccgcacccgcattca
ttctacagggatggaaacgaaacacgaaatgttgaagctgttatcaagagaggaaagggc
atcgatatccgtagtggaattgttgggcttttagttttaaagagtactggttcgcaattc
cacggatttgttagagacgagtatactacgctccccgaggtttgggatagaattttgtcg
actgatgttgactgtggctgggcttggaaaacattcgctggattggacgctgttaaagag
gccattcccaaatttgataaagcatttgatgatgctagaaatatcaccatgaagacattc
gctgaggagaacagtccatctgtacaaaacactatgtacaagatgtgcaattctatttta
gagactgtcccagaagtcgaggctgtggattattctttacccaacaagcattatttcgaa
gtcgatctcagctggcataagggtctcaagaacaccggcaaggatgcagaagtttatgct
cctcaatccggaccaaatggacttatcaatgtcaccgtcaccagatcccccgcctcgcca
aaactatag

DBGET integrated database retrieval system