KEGG   Sclerotinia sclerotiorum: SS1G_00214Help
Entry
SS1G_00214        CDS       T01071                                 

Definition
calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ssl  Sclerotinia sclerotiorum
Brite
Protein phosphatases and associated proteins [BR:ssl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SS1G_00214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 174 aa AA seqDB search
MGNTSSAVLENIVQGSNFDRDEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDRDGKISFEEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacaagcagtgcagtattggagaatattgtgcaagggtctaactttgatcga
gatgaggttgatagattaagaaaacgttttatgaagttggataaggataactctggtacc
attgaacgtgaggagtttctcagccttccgcaaatctcatcaaatcctctagctactaga
atgatcgccatattcgatgaggatggaggtggagatgtcgattttcaggaattcgttagt
gggctcagcgcatttagtagtaaaggaaacaaggaacaaaagctccgattcgcattcaag
gtctatgatattgatcgtgatggatacataagcaatggggaattattcatcgttttgaag
atgatggtgggaagtaatttgaaggatcaacaattacagcaaattgtcgacaagacaatt
atggaggcagatttggatagggatgggaagattagttttgaggagttcacaaagatggta
gagaacacggatgtgtctatgagtatgacattagatcaattttga

DBGET integrated database retrieval system