KEGG   Sclerotinia sclerotiorum: SS1G_00214Help
Entry
SS1G_00214        CDS       T01071                                 

Definition
(RefSeq) calcineurin B subunit
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ssl  Sclerotinia sclerotiorum
Brite
Protein phosphatases and associated proteins [BR:ssl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SS1G_00214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 5494742
NCBI-ProteinID: XP_001598128
UniProt: A7E4J2 A0A1D9PZH7
Position
Unknown
AA seq 174 aa AA seqDB search
MGNTSSAVLENIVQGSNFDRDEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDRDGKISFEEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacaagcagtgcagtattggagaatattgtgcaagggtctaactttgatcga
gatgaggttgatagattaagaaaacgttttatgaagttggataaggataactctggtacc
attgaacgtgaggagtttctcagccttccgcaaatctcatcaaatcctctagctactaga
atgatcgccatattcgatgaggatggaggtggagatgtcgattttcaggaattcgttagt
gggctcagcgcatttagtagtaaaggaaacaaggaacaaaagctccgattcgcattcaag
gtctatgatattgatcgtgatggatacataagcaatggggaattattcatcgttttgaag
atgatggtgggaagtaatttgaaggatcaacaattacagcaaattgtcgacaagacaatt
atggaggcagatttggatagggatgggaagattagttttgaggagttcacaaagatggta
gagaacacggatgtgtctatgagtatgacattagatcaattttga

DBGET integrated database retrieval system