KEGG   Sclerotinia sclerotiorum: SS1G_00301Help
Entry
SS1G_00301        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SS1G_00301
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SS1G_00301
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SS1G_00301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 160 aa AA seqDB search
MRAYWFDNKEGDQRELHDSGRDVDPEYLEKLGVLYYHFADEKDVDKLASDRSYKNRDVIT
VSPQKMGDVYEEKVKMFFNEHLHEDEEIRYIRDGAGFFDVRSEGDEWVRIRLEKDDLIYI
QAMRLFKEEPKWTPLNRGPEVDANPYRKEYLQTVPAIASQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttactggtttgacaacaaggagggcgaccaacgcgaacttcatgactcaggt
cgcgacgttgatcctgaatacttggagaagcttggggttctctattatcacttcgcagac
gaaaaggatgtcgacaagctcgcctcggacagaagctacaagaatcgcgatgtaattacc
gtttcaccacagaaaatgggcgatgtttacgaggagaaggtcaagatgttctttaatgag
catttgcatgaggatgaggaaattagatatataagagatggtgcgggatttttcgatgtt
agaagtgagggcgatgagtgggtgcgcattaggttggagaaggacgatttgatctacatc
caagcaatgagactgttcaaggaggagcccaaatggacacccctgaaccgtggtccagaa
gtagatgccaatccataccgcaaggagtatctgcagactgttcctgcaattgccagtcag
tag

DBGET integrated database retrieval system