KEGG   Sclerotinia sclerotiorum: SS1G_00312Help
Entry
SS1G_00312        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SS1G_00312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1150 aa AA seqDB search
MAGAAAAVFMDGEPSRSLATSEDDADFEEDDMIPDIINEDANAYAANIQLQNGLMGNHSD
MEDDREGPEGEEDMLTDEDADGEEDDRMLDEREHMEHTEEEEIDENLGPGEGDEDDDDAE
GVGAVKIQPGLEDDDDEDAESGSDSDSSAEIEEEDDESKDSSDVEEEIRWQSNGEEGEEE
EEGHVNPNRCIFCEQDEDDDPSEEFELYLACEMCGDNAHRQCARNSDALKSDEEAENWYC
PGCHKNRLVPGSPSADVDMLEAPDEEEDGEAEINDEDLPVEAAERRISRDRVPGDLLPPR
REDPMDGSRLLRKRKTSSVEADEGLVLRKRTRDRDTLSDYSKPSFDEPHDEVKVDNDSNL
SLTNGKRNKRRADGPTSPRVSRSQRQKTSSSSNPPVSIVEKVTGTLKICFRIDPLELRHI
LSLPPRPKKKRGGRGVSKARSTATSSALVPSSYSRPFYPSIHDKELEELKSKPYGGILSE
ADADTSLTLPRAEHRRQFEEARQKAEEDWKARAAAAAEAAAKAGLRKARKVSGPASQIEY
IDFGAYQIDIWYAAPYPEEYSRNKALFICEFCLKYMESDIVAWRHKTKCPWKHPPGDEIY
RDGKIMIFEVDGRKNPLYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEYDELGCHFVGY
FSKEKRPSSLNNVSCILVLPIHQRKGYGHLLIDFSYLLTRVERKTGSPEKPLSDMGLVSY
RNYWRLVLCYYLQKFEPSGRIPSIKAISDEMGLTPDDVISGLDAMGTLVRDPMTGTYAMK
LKPEYYKEVIRQHEAKGYAKLNPKGLVWTPFVMGRGNASAYDHAPPLNTVAPREEDEDEV
PSVEGISNASVQGAALNGLTNGDTGEMTASLGKMTTEAGDGVRVASSEGSVGKSTVSQKL
NGITKKSYYDLASSIPPVRFVVFPPLPGARSRTISRPSLARPSPRARPSVSSSARPKPRR
GSGIPIRRASTTSASAPKPRAVARRKSGGTGRGPGRWPKGTKKSDFGNADSGPGLPPRLL
KQRSKLGNEVLLGEEEENDEAKSDQDESAIYDTPAPRSRRDRDSSRKGAGLGKPILLGKG
KGKGPATGKGKSPLVDAEGNQEMADAPVDEVEAYQDGNVDADADADADPDFEAISYRGAG
EDVDAHGEDE
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagcggcagcagcggtgttcatggatggggagccttcacggagcttggctact
tcagaagacgatgctgatttcgaggaggatgacatgattcccgacataattaatgaggat
gcgaatgcatatgctgccaatattcaattacaaaatggtttgatgggaaatcacagtgac
atggaggatgatagggagggtccagaaggtgaagaagatatgttaacagacgaagatgcg
gacggagaggaggacgatagaatgctcgacgagcgagaacatatggagcatacagaggag
gaagagatcgacgagaatttagggccaggtgaaggagatgaggatgatgacgatgctgag
ggagttggtgctgtcaagattcagcctggcttagaggatgacgatgatgaagatgcagag
agtggttcagacagcgacagctctgcagagattgaagaggaagatgatgaatctaaggac
tctagcgacgtcgaggaagaaattcgatggcaatctaatggagaggaaggagaagaggaa
gaggaaggacatgtaaatcccaatcgctgcatattctgcgagcaggatgaagatgacgat
ccaagtgaagaattcgaactttatttggcatgtgagatgtgtggagacaatgcgcatcgg
caatgcgccagaaattcggatgcactcaaatccgacgaagaggcggaaaattggtattgt
ccaggatgtcataaaaatcgtcttgtgcctggaagtccaagtgcagatgtcgatatgctc
gaagccccagatgaagaggaagatggagaagcagaaattaatgatgaagatctgcccgtt
gaagcggctgaaaggagaatttcaagggacagggtcccgggagatttattaccgccaaga
cgtgaagatcccatggatggctcacgtttgttgcgcaagaggaaaacttcttcagtggag
gctgatgagggtctggttctgagaaagaggaccagggatcgggatactctttccgattat
tccaaaccatcgtttgacgaaccacatgatgaagttaaagtcgacaatgatagtaacttg
tcattgaccaacggtaaaagaaacaagagaagggcggacgggcctacaagtccacgtgtc
tcaagatcccagcgtcagaaaacttcttcatcttcaaatccgcctgtcagtatcgtcgag
aaagtaaccggcaccctcaaaatttgctttcgcattgaccctttggagttgagacatatc
ctctcactaccccctagaccaaaaaagaaacgtggcggccggggtgtatcaaaagctcga
tccacggctacttccagcgcccttgtcccctcaagttattcacgaccgttctacccttcc
attcatgataaagaattggaggaactaaaatctaaaccctacggtggcattctttccgaa
gctgacgccgacacgtctttgacactccctagagcagaacatcgacgtcagtttgaagag
gctcgtcaaaaagcagaagaggattggaaagcaagggcggcggcggcggctgaagctgct
gccaaagcaggattgagaaaagcacgcaaggtgtctggcccagccagccaaatcgaatat
attgatttcggggcatatcagatcgatatctggtatgccgctccatatccggaagaatat
agtcggaataaagcacttttcatatgcgagttctgtttgaagtacatggagtccgatatc
gtcgcttggagacacaaaacgaaatgtccatggaaacatcctcctggtgacgaaatatat
cgagatggaaagattatgatctttgaagtggatggacgtaagaacccactttactgccaa
aatctttgcctcttagcaaaactttttcttggatcaaaaactttgtactacgatgttgaa
cctttcctcttctatgtcatgacagaatatgacgaactaggctgccattttgtaggttac
ttttcgaaagagaagcgacctagcagtctcaacaatgtctcgtgtatcctcgtgctgccg
attcatcaacggaagggatatggccacttgctcatcgacttctcgtatcttctcacacgc
gttgagaggaagactggctctcctgagaaaccgctttccgacatgggtctggtctcttac
cgcaattactggcggctcgttttatgttattacttacaaaagttcgagccctctggacgt
attccaagtatcaaggctatttccgatgagatgggtttgacgccggatgatgttatctca
ggccttgatgccatgggcacgctcgtccgtgatcccatgactggtacctatgccatgaag
ttgaagcctgaatactacaaggaggtcattcgtcagcatgaagcgaaaggatatgccaaa
ttaaatcctaaagggctggtctggacgccgtttgttatgggtagagggaatgcttctgct
tacgatcatgcaccgccgctgaacaccgtcgcaccacgtgaggaagacgaagatgaagta
cctagcgttgaaggtatatctaatgcgagcgttcagggcgctgcattgaatggtcttacg
aatggtgatacaggagagatgacagcatcgttaggcaagatgaccaccgaggctggtgat
ggtgttagagttgcaagttcagaaggcagtgttgggaagtcaacggtgtcgcagaagctc
aatggcattaccaaaaagtcatactacgatcttgcctcttcaattcctcctgtacgattt
gtggtgtttcccccgctacctggtgctcgaagccgaactatctcacgcccctctttggcg
cgaccttctccacgcgcaaggccgtcggtctcttcatctgctcgacccaaacctcgacgg
ggaagcggaatacccattcgtcgtgcgtccactacatctgcatctgcaccaaagccacgg
gctgtagcacgtaggaaaagcggaggtacgggtcgcggacctggtagatggccaaaggga
actaagaagagtgatttcggcaatgccgacagtggtccgggcttaccccctagattgtta
aaacagcgaagtaagttagggaatgaggtactactcggcgaggaagaagaaaatgatgag
gcaaaaagtgaccaggatgaatcagcaatctacgatactcctgcgccgagatcgagaaga
gatagagactcgtcacgcaagggtgccgggctaggcaagcctattctcttgggcaaaggc
aaaggcaaggggcctgctacaggaaaaggcaaaagtcctctcgttgatgctgaaggaaat
caagaaatggctgacgcgccagttgacgaagtagaagcttatcaggatggtaatgtggat
gcggatgcagatgccgacgcagatccagacttcgaggcgatttcgtatcggggtgctgga
gaggatgtggacgcccacggcgaagatgaatag

DBGET integrated database retrieval system