KEGG   Sclerotinia sclerotiorum: SS1G_00451Help
Entry
SS1G_00451        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SS1G_00451
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SS1G_00451
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SS1G_00451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 581 aa AA seqDB search
MMHPTPPPSIPFGDIDSYKYRRDAEFRNVEAPQSEDPEYVEHIEQTKSHLPENLTETEEE
QEKHWFIGSIDQGTTSTRFIIFNGQGQPVAMHQHEFENMYPESGWHEHDPQELVNSVDEC
IDKATEKFLELGYKKSDIKAIGITNQRETTICWDTNTGEPLYNAVVWPDTRTTALVRELK
DSEGADEILQLCGLPLSTYPSSVKLMWMYRNVEAIKNAYDEGRLSFGTVDSWLIYKLNGG
KEGGIHVTDTTNASRTMFMNLHTLQYDDKLLNFFQLDRKNVTLPKIVPSSDKEAFGKLAY
GALKGTRITGCLGDQSSALVGQCGFKPGHAKNTYGTGCFLLYNVGTKPVVSKYGLLATVA
YDFGNGRKPVYALEGSIAVAGSGVKFLMNNLGFIAHSSKITELAETVDDNGGVVFVTAFS
GLFAPYWIDDAKGTLFGITQHTQRGHIARATLEATCFQTKAILDAMEKDSGHKLEGLAVD
GGMSNSDLCMQTQADILNIPINRPVMRETTALGAAIAAGFAVGIWKEFDELKEINRDDRT
IFEPKVKPAKAARMFKKWEQAVEMSRGWVIHAEDENNDDVD
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatcccacaccaccaccttcgatcccatttggtgatatcgacagttacaagtac
aggagagatgcagaatttagaaacgttgaggctccacaatcagaggatccagaatatgtt
gagcacatcgaacaaacaaaatcacatctgccagagaatttaaccgagaccgaggaggaa
caagagaaacattggtttattggtagcattgatcaaggcacaacttccacaagattcatc
atcttcaatggtcaaggacaaccagtggcaatgcaccagcatgaattcgagaacatgtat
cccgagtccggatggcatgaacatgaccctcaagagttggtcaactcggtggatgaatgt
atagacaaggcaacagagaagttcctcgaattgggatacaagaagtccgacatcaaagcc
attggaattaccaaccaacgtgaaaccaccatctgctgggatacaaacactggggaacca
ctatacaatgccgttgtctggcctgacacccgaaccacagctcttgtgcgcgagcttaag
gattccgaaggagcggacgagatccttcaattgtgcggtctgccactatccacataccca
tcgagcgttaagctcatgtggatgtaccgaaacgttgaagccatcaagaacgcatacgac
gaaggcagattatctttcggaacagttgactcttggttgatctacaagctcaatggagga
aaggaaggtggcattcatgtcacagacaccacaaacgcttctagaactatgttcatgaac
cttcacacattacaatacgatgataaactcctcaacttcttccaactcgacagaaagaac
gtcactctcccaaaaattgttccttcctctgacaaagaggcctttggtaaacttgcatat
ggtgctttgaaaggtaccagaatcactggctgcttgggagaccaatcttccgccttggtt
ggtcaatgtggcttcaaacctggtcatgcaaagaacacctacggaactggttgtttcctt
ctctacaacgttggcaccaaacccgtagtatcaaagtatggtcttttggctactgtcgca
tacgattttggtaatggcagaaaaccagtctacgctcttgagggtagcattgctgttgca
ggctctggtgttaaattcttgatgaacaacttgggtttcattgcacactctagcaagatc
actgaattggcagagactgttgatgacaatggtggtgtggtatttgttactgccttctct
ggtctcttcgccccatactggattgatgatgccaagggaacacttttcggtatcactcaa
cacactcaacgaggtcacattgcccgtgctaccctcgaagctacctgtttccaaaccaaa
gccatcctcgatgctatggagaaggattccggacacaaattggaaggacttgccgtcgat
ggtggcatgtctaactcagacctttgcatgcaaacacaagctgatatcctcaacatccca
atcaacagacctgttatgcgcgaaaccactgctcttggtgcagcaattgcagcgggtttc
gcagttggtatctggaaggagttcgatgaactcaaggaaatcaatcgcgatgaccgaacc
atcttcgagccaaaagtcaagcctgcaaaggctgcacgcatgttcaaaaagtgggagcaa
gcagttgagatgagcagaggatgggtgatacatgcagaggatgagaacaacgatgacgtt
gattaa

DBGET integrated database retrieval system