KEGG   Sclerotinia sclerotiorum: SS1G_00509Help
Entry
SS1G_00509        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SS1G_00509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MLTVSNLTALAALLSHINVSMAQGQAYSQYYSQCLPGSATSAPAPLTTLVTSKISTTAGT
SPISTGSSVNDKFVAHGKKYFGVATDQGRLTSGDNAAIIKADFGQVTPENSMKWDTIEAS
QNNFNFAGGDYLVNWATTNSKLIRGHTLCWYSQLPNWVSSITSAATLTAVLEHHVTQEVT
RWKGKIYAWDVVNEIFNEDGSMRTSVFYNVLGESFVSIAFKAARAADPNAKLYINDYNLD
SATYAKLTKGMVAHVKTWIAQGIPIDGIGSQSHLQAGQGSAALGALTALAASGVSEVAVT
ELDIAGAAATDYVNVVNACLRVTKCVGITVWGVRDPDSWRASSSPLLFDANFAPKAAYNA
ILAAL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcttacggtatccaaccttacggctttggcagctctgctaagtcacatcaatgtgtct
atggctcagggtcaagcttacagtcaatattactctcaatgccttcctgggtctgccacc
tctgcccccgctcctttgacgacattggttacctcgaaaatatccacaactgcgggaaca
agcccaattagcactggcagcagtgtcaatgataaattcgttgcacatggcaagaaatac
tttggagtcgccactgatcaaggtcgtcttacatccggcgataatgcagctatcatcaag
gccgattttggacaagtcaccccagaaaatagcatgaagtgggacacaattgaggcatca
caaaacaatttcaactttgctggtggcgattacctagtaaattgggcgacaactaattcg
aagctcattcgtggtcacacactttgctggtattctcaactcccaaattgggtcagctcg
attacatctgcagctacactcacagctgtccttgaacatcatgtcacacaggaagtgact
cgctggaaaggaaagatatacgcatgggacgtcgtcaatgagattttcaacgaagatggc
tccatgagaaccagcgtgttctataacgtcctcggagaaagctttgtttccatcgccttt
aaagccgctcgggcagctgaccccaacgcaaagctctacatcaatgattacaatttggac
tcggctacctacgctaaacttaccaagggtatggtcgcacatgtcaagacatggatcgct
cagggaattcccatcgatggcattggttcacaatctcatcttcaagcaggccagggatca
gctgcattgggtgctttaactgcacttgcggcttctggtgttagtgaagttgcggttaca
gaattggatattgcaggagcagctgctactgattatgtcaatgtcgttaatgcttgtttg
agggtgactaaatgtgtcggtattacggtctggggtgtccgtgatccagactcatggcgc
gcaagctcatctccattgttgtttgatgccaactttgctccaaaggctgcttataatgcc
atattggcagctttgtag

DBGET integrated database retrieval system