KEGG   Sclerotinia sclerotiorum: SS1G_00741Help
Entry
SS1G_00741        CDS       T01071                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SS1G_00741
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SS1G_00741
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SS1G_00741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 172 aa AA seqDB search
MASATSIYEFEPLNKKGEPTPLADYKGKVLLIVNTASKCGFTPQYEGLEKLYKDMKEKHG
DDFVILGFPCNQFGGQDPGTDEEIQSFCQINYGVSFPIMKKVDVNGDNAAPLFKWLKEEK
PGLLGLQRVKWNFEKWLVGRDGKVKQRWASTTKPESLEKPILEALNETKSEL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctacttctatttatgagtttgaacctttgaataaaaaaggcgaaccaact
cctctcgcagattacaaaggcaaagtccttttaatcgtcaacacagcttccaaatgtggt
ttcactcctcaatacgaagggctcgagaaattatacaaagacatgaaggagaaacatgga
gatgatttcgtaatcttaggatttccatgtaatcaatttggaggacaagatccgggaacc
gatgaggaaattcaaagtttctgtcagattaactatggagtttcttttcctatcatgaaa
aaagtcgacgtaaacggcgacaatgcagctccactcttcaaatggctcaaggaggaaaaa
ccaggtcttctcggtcttcaacgcgtaaagtggaatttcgaaaagtggttggtgggtaga
gatggaaaggttaagcagagatgggctagtactactaaaccggaatctttggagaaacct
attttggaggctttgaatgagacgaagtcggaactttga

DBGET integrated database retrieval system